ELF>0$@P(@8 @## #CCpx. 05$05D05D888$$### Std### PtdPPPkkQtdRtd#CC``GNUx'>Y~<<x- $Q!x`|<ҤB^??   /~ B J u k C z  |j  MCo3 F-# 0  L  1& <  R |s  |lRq b  *H , EqQF"I 0M *H T   : fcrf # f L   A Z -z : R@,@O    ef7)KY s |U90g    [ J*  ) "m r   ^8  S>;}  4P4  v b5Il% _;"#"  '  +       @        0 __gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalize__stack_chk_faildm_event_handler_createdm_event_handler_set_dmeventd_pathdm_event_handler_set_dsodm_event_handler_set_uuiddm_event_handler_set_timeoutdm_event_handler_set_event_maskdm_event_handler_destroystrlenstrncmpstrcmp__lxstat64strdupdm_event_get_registered_devicedm_event_handler_get_event_maskdm_event_unregister_handlerdm_event_register_handlerusleepdm_event_handler_get_dsocallocmallocstrncpystrcasecmpfopen64strstr__getdelimfclose__errno_locationstrerrorunamectime_r__ctype_b_locumaskgetenvfgets__xstat64sd_id128_get_machine_app_specificfcntl64stdinstdoutsetlinebufmalloptsetlocalegetpidsyscallsetvbufmemmovestrchr__ctype_toupper_locstrtollstrtodfputc__fprintf_chkstrspnfwritememcpymemsetio_submitio_destroylseek64io_geteventsio_setupsysconfposix_memalignreallocstrcpyalphasort64scandir64opendirreaddir64closedirsscanfudev_enumerate_newudev_enumerate_add_match_subsystemudev_enumerate_scan_devicesudev_enumerate_get_list_entryudev_list_entry_get_nameudev_device_new_from_syspathudev_device_get_devnodeudev_device_get_devlinks_list_entryudev_list_entry_get_nextudev_device_unrefudev_enumerate_unrefmkdirflockunlinkstrtolctimefflushrenamefsyncudev_device_new_from_devnumudev_device_get_is_initializedioctl__fxstat64udev_device_get_property_value__snprintf_chkreadlinkstrrchr__memcpy_chkdirname__xpg_basenameblkid_get_tag_valueblkid_new_probe_from_filenameblkid_probe_enable_partitionsblkid_probe_set_partitions_flagsblkid_probe_enable_superblocksblkid_probe_set_superblocks_flagsblkid_do_probeblkid_probe_lookup_valueblkid_free_probeblkid_probe_step_back__sprintf_chk__ctype_tolower_locgetcstderr__vfprintf_chkfeofversionsort64fdopenrand_raccessferrorfputs__vsnprintf_chklocaltimestrftime__strncpy_chkprlimit64snprintfclock_gettimelocaltime_ropenlogcloselogsd_journal_printv_with_location__vsyslog_chkabortdup2fscanfsd_journal_send_with_locationqsortstrtoul__assert_failforkwait4execvppipewaitpidgethostnamesigprocmasksigactionsigismembersigdelsetsigaddsetsigfillsetudev_unrefudev_queue_newudev_queue_get_udev_is_activeudev_queue_unrefudev_newgetpagesizegetrlimit64mallinfomlockallmlockmunlockallmunlockgetprioritysetprioritysd_bus_open_systemsd_bus_call_methodsd_bus_message_readsd_bus_error_freesd_bus_message_unrefsd_bus_flush_close_unrefsd_bus_error_has_namestrncasecmpmktimesymlinkrmdirsetmntentgetmntentendmntent__printf_chkputcharstrtoulloptargoptindgetopt_longgetuidgeteuidnl_langinfoperrorgetppiddirfdunsetenvnanosleeprewindsetsidlvm2_disable_dmeventd_monitoringlvm2_log_levellvm2_log_fnlvm2_exitlvm2_runlvm2_initlvm2_init_threadedsocketconnect__fdelt_chkselect__xmknodmemchrselabel_lookupselabel_opensemctlsemopsemgetstpcpysetfscreateconfreeconis_selinux_enabledlsetfileconselabel_closechownftruncate64gmtime_risspacememccpynearbyintpthread_mutex_lockpthread_mutex_unlockstrndupmemcmplibdevmapper-event.so.1.02libdevmapper.so.1.02libreadline.so.7libsystemd.so.0libblkid.so.1libaio.so.1libselinux.so.1libsepol.so.1libudev.so.1libm.so.6libc.so.6liblvm2cmd.so.2.03BaseLIBAIO_0.4LIBAIO_0.1GLIBC_2.2.5LIBSYSTEMD_222LIBSYSTEMD_233LIBSYSTEMD_221LIBSYSTEMD_209LIBUDEV_183BLKID_2.23BLKID_1.0BLKID_2.17BLKID_2.15GLIBC_2.15GLIBC_2.13GLIBC_2.14GLIBC_2.4GLIBC_2.28GLIBC_2.3GLIBC_2.17GLIBC_2.3.4                0t0 q0   ui 1   r Pb b$ b3 bB   #Q  PA ] eh A r A }     ii   ii  ti ui  C&C$C%C@$CCCCXClCCCCCCXC@CPHCPC`CVhCfpCVxCACCCCCVC\XCCCDC@ȡCC5C? CH8CdPCphCyCCxCȢCCC‘C(CՑ@CXCޑpCޑCCC УCC0CCI0CeHCq`CxCCCCŒؤCCʒC C8CPC`C!hCpCXxC[CCCC C?CICSȥC]CCC0CHC`CxCCCCUئCCC. CH8C]PCihCyCCCȧCCHC`CxCCC C8CPChCCCyCȬC@CHCPCEXCm`CPhCKpCxCOCCRC6Ci%CVCAC|CȭCCЭC\C C C C C C f CD C CD (C 0C 8C @C HC PC{ XCP{ `C f hC pCP xC CG C C C C CD CE Cp C@E ȮC ЮC E خC C C`E Ct CE C C } CE C@ CЉ (C` 0C 8C @CE HCPt PCE XC| `C hCF pC xC@ CЊ C C C F CF C_ C@F C`F C ȯC ЯC دCF C C CF C CF C` C C C A (C` 0C 8C @C HC PC XC `CP hC pC xC C C C C C G C` CP3 C CP ȰCD аC ذC C C C C C C C C C (C 0C 8C @C HC `CwhCxpCxxCxCxCxCxCxCyCyCyC$yC-yȱC XCC CC3 CpC3 xCؐCP3 C0C3 8CCA CCP[ CPC? XCC C0C C!pC@ xC'C C<0Cp 8C`C CC0A CQPC@ XCC CnC CpC xCPC@ C0C 8CC CC CجPCP XCCP C0CZ CfpC xC`C C0C@ 8CC@ CC CPC XCHCP@ CC? CppCZ xCC ? C0C 8C!C> CC CPC` XCʑC  CCp CpC` xCC C0C 8C&C C>Cp CPC XCCP CCP CpCp xCHC Cp0C 8CCP CCP CȯPCP XCCP C0CP CSpC xChC` Ch0C 8CwCP CCZ CfPC@\ XCذC CC@ C0pCP xC`C C0C: 8CرCP: CC@ CPC XC8C`< ChC9 CpC( xCC9 Cز0C9 8CC C8C C`PC XCCp CC6 C8pC\ xCxC02 C0C 8CдC CC2 C0PC( XCC CC CpC xC8C C`0CZ 8CfC1 CC 1 CPD0 XDPD@0 DD/ DpDP/ xD D# DP0D` 8DD DDP DPD XDD; D0D`= DXpD@( xDDP D0D_ 8DDp` DйD' DPD`' XD D& DҒD& DHpD& xDD% D0D0% 8DغD$ DD# D@P D@; X Dh DP D DP  D D D D0 D D D  D D D  D/ D  D3 D/ D ( DN0 D/8 D H DP D/X D h Dkp D{x D D D{ D D DƓ D D Dē D D D D˓ D  DZ ( D0 DH DPP DDX Dh DDp DDx D DD DD D DD D`D D DpD D@D D D`D D D D DPD DD D( D@D0 DD8 DH D0DP DDX Dh D Dp DDx D DD DD D DD D`D D DD D@D D DD D D DDDDDD(DD0DD8DHDDPDDXDhDDpDDxDDDDDDDDD`DDDpDD@DDD`DD DDDPDDDD(D@D0DD8DHD0DPDDXDhD DpDDxDDDDDDDDD`DDDDD@DDDDD DDDDDDD(DD0DD8DHDDPDDXDhDDpDDxDDDDDDDDD`DDDpDD DDD`DDDDDPDDDD(D@D0D`D8DHD0DPD DXDhD DpDDxDDDDDDDDDDDDDDDDDDD`DDDDD0DD(DD0DD8DHDDPDDXDhDDpDDxDDDD`DDDDD DDDpDDDDD`DDDDDPDDDD(D@D0DD8DHD0DPDDXDhD DpD`DxDDDD@DDDDD DDDDDDDDDDDDDDDDD(DD0DD8DHDDPDDXDhDDpD`DxDDDD@DDDDD DDDpDDDDD`DDDDDPDDDD(D@D0DD8DHD0DPD`DXDhD DpD@DxDDDDDDDDDIDDDDIDDDDDDDDDDD(DD0DD8DHDDPDDXDhDDpDpDxDDDDDDD D D(Dn8DmHDhXDhDxDEDDDDDDDDDD(D8DHDXDhDxDDDDDDDDDDD(D8DHDXDhDxDDDDDDDDDDD(D8DHDPXDhDExDDDDDDDDDDD(D8DHDXDhDxDDDDDGD$D]DHDcDTDmDl Dt(Dl8Dx@DxPDXDxhDpDDDDDDDDDDDDDDD(D0D@DHDXD•`DpDǕxDDЕDDוDD:DDەD,DID,DJD,D DD0D8DDHDPDD`DhD\xDDhDDtDDDDDDDDDDԾ D (DԾ8D@DPDXDhDpDD"DD&DD,DD0DD4DD9 D D= D( DB0 D@ DFH D(X DM` D(p DQx D4 D[ D4 D_ D@ Dg D@ Dk DL Dt DL!Dx!DX!D !DX8!Dp!D5!D?!DH!Dd!Dp!Dy"D"Dx0"DH"D`"Dx"D‘"D"DՑ"D"Dޑ"Dޑ#D #D8#D P#Dh#D0#D#DI#De#Dq#D#D$D($D@$DŒX$Dp$Dʒ$D$D$D$D$Dܧ%D6 %D8%DP%Dh%D%D%DD%D@D%D0 %D&D&D(&D8&DH&DpX&D0h&Dx&DP&D0&D0&D0&DM&D &DO&DH'DO 'D&8'DP'Dh'DP'Dl'D 'D'DX'D P'D(DP((DC@(DLX(Dp(DP(D(P(D0P)D)Dp)Dox)D0)Do)D0*Do*D0*Do*D0h+D;p+DCx+Do+D+D+D Y+DP+D+D+D+D,D0,D (,D 8,DЙH,D(X,D)h,D)x,D -,D},D`,D,D@,DЁ,D,D,DP-DP-DЅ(-DP8-DPH-DX-D`h-D`x-D-DP-DP-D-D@-D@-DP-D-D.D.Dp(.D`8.DH.DX.D@h.Dx.D.D.D.D.D0P?D>X?DGh?Dp?D`U x?D ?DG?DM?D J?D`7?D?D @D@D@D@D @D @D(@D @D0@D0@D8@D0@D@@D@@DH@D@@Dp@D0x@D@D@@D@D`@DP@D@@DPAD AD@ AD0 (ADP 8ADXAD `ADhAD@ AD#AD@>AD HAD06AD+AD`+BD0%BDPBD#XBDB`BD`hBDpDBD`+BD0%BDBDC8CDh`pCDCDqCDCCDLDDH(DD`DDxDDe DDDDCEDEDPEDhEDcEDFD@FDXFDUFDFDFDCFDB@0GD8HGDEEGDpGDCGD GDCGDHD HD !8HDэHHDCpHDX!HDb HDCHD!HDC(IDD`ID"xID"DID\XID#IDIDmNJD$JD>DPJD(&hJDNDJDP)JDC?JD^DJDH*KDmDKD@KD+XKDQhKDDKD-KDDKDDKD3KDޒLDLDHLDDXLDhLDLDDLDLDD8MDZ pMDx4MDDMD05MDDND5(NDD`ND8xNDDND END8ND!EOD9OD8E(ODPODp;hODLEODx=ODhEOD>PD{E@PDh?XPDEPD0@PDEPDCPD D0QD@DHQDEQDPFQDEQDGQDE8RDEpRD0KRDFRDpKRDFSD@L(SDN`SDNxSD*FSD(QSDBFTDQTDQFPTDThTD`FTDqFTDUTDxWTDWUD0[@UDX[XUDFUD[UD\UD\UDFVD1(VD8]0VDFHVDFVDx]VDVD1VD(^VD WD`_8WDpWD`WDWDx`WDFWDXD`(XDF`XDcxXDcXDcXDGYD8dYD GPYDehYD/GxYDYDeYDBGYD^GYDeZDfG@ZDhXZDtGhZDZD@hZDGZDiZDG0[DiH[DG[Dj[DG[Dpk[DG \D8l8\DGp\Dl\DH\Dm\D$H]Dn(]D>H`]D(ox]DSH]DXo]DlH^Do^D}HP^Dph^DH^D0q^DH^DPr_DH@_DrX_DH_Ds_DH_Dt_DH0`DPvH`DHX`D`Dw`DI`Dz`D aD|8aDIpaD}aD1IaDBIaD`aDNIaDbD(bD_I8bD`bD@xbDoDbD(bDuIcD`cD|IPcD(hcDfcDPcD;AcDdDI@dD@XdDIdDxdDIdD(dDI0eDXHeDDXeD*eDeDceDeDI8fDIHfDpfDPfD`fDhfDfDrfDhgD(gDe `gDhxgDIgDpgDИgDЍgDwhD(hDI(hD8hDPhDhhDIhDhDIhDiDI@iD8XiDIiDpiDSiDiDJjD$0jDPHjDJjDxjDDjDjDc kD08kDJkDȤkDkD*J(lD;JxlDNJlDMJlDSJlDrJlDqJlDvJmD8mDJhmDJmDpmDJnDJXnDJhnDJxnDJnDnDKnDhnDK0oDHoD$KXoD4KoDJKoD@oD8pDcKppD(pDvKpD'pDKpDhpDKqD(qDK8qDKHqDK`qDxqDKqDSqDLqD8qDrD0rD)LPrDhhrD:LrDFLsD_L@sDئXsDgLsDsDtLsDsDL0tDHHtDLXtDtDtDLtDLtDLtDtDLtDMuDM uDX8uD)MHuD@MXuDVMpuDuDhMuDuDuD{MuDMvD0(vDM`vDhxvDMvDvDMvDMvDMwDwDN(wDN8wD+NPwDPhwDP~D`~D.P~D`~DJP D@8D`PhDpDDsPDD7D(DS8D`DxDPDPD@ȀDP؀DDDP(DPPDhDPxDHDDDPDDQ@DXD`DD+QDhDHQ0DHDfQDDQЃDDQ D8D@pD8DQD؄DQDX(DQ8DQ`DxDQDȅDQDpDQPDhD RDxDRDD(F@D@XDKDD8RDpD DGR0D8HD= DXRD]R8DhRDrR؉D*(DBxDRDRDȊDRDDR(DPD( hD;D D#JD DD@D XDHhDD8 DRDRDh DC0D HDJD DRЍDDR D`8DRHDSpD8DSDSD ؎D+SDh!D!(D9S8Dh!`D"xDOSDXSD"ȏDhS؏D#D#DqS(D#PD$hDSxDSD0%DSȐD%D%DSDH&@D&XDShDSD 'DSD'D'DSD((0Dh(HDSXDSD(DTDh)ВD)D TD* Dh*8DSHDSpD*DTDx+D*ؓDTD+D8,(D2T8D@T`D,xDGTDUTDH-ȔD\TؔDjTD-DqT(DTPD8.hDsTxDTD.DTȕDSD@/DTDS@D/XDThDXSD@0DTDTD0DTDT0DX1HD UD1D!UЗD2D9UD2 D28DHUHD3DUUD4D(4ؘDfUD85DX5(DJ8DsU`DX6xDUDUD7șDJؙDsUD8DM(DU8DUPD9hDUD9D0D8:D@D<XDUD=DUD0?DV0D@DuDv؝DvD0vDv8D yHDwDwDDDDОDp؞D0D&DD.D"D 5D4D@4 DP6(D40DPDQXDQ`DBhDpBpDPBxDAD`;D DD D D0 DP D ȟD DPDD DDPDDDD Dq(Dp0Da8D@DHD0PDXD`DhDЙDDJ D I D0T DF DO ȤDA ФDN ؤDL DL DA D`A D0A DA hDoDcppDjppD xD D@ D@ D D D D@ D D ȩD` ЩD ةD D DT D (D 8D`SPD XD hDlD` D DyD0 D ȪDD D DD D (D@D HD XDpD xD DD D DЫD ثD D΃D D Dك0D 8D HD`D hD xDD D DD ȬD جD D D D3 D (D 8DEPD XD hDRD D D\D D ȭDnD D DD D (D@D HD XDpD0 xD DDP D DЮDp خD DD D DЄ0D@ 8D HDH`DP hD xDڄD D DD ȯD دDD D D D (D 8DPD XD hD D D D4D D ȰDHD@ D DYD D (Dk@D HD XDpD xD DFD D DxFбD رD DD D D0D 8D HD`D hD xD…D D DͅD` ȲD زDKD0 D D݅ D (D 8DPD XD hDD D DDp D ȳDD@ D D D D (D@D HD XDpD xD D'D D D2дD` شD D>D0 D DF0D 8D HDV`D hD xD^D D DiD ȵD صDD D Dw D (D 8DPD` XD hDD@ D DD D ȶDD D DȆD D (Dֆ@D HD XDpD xD DD D DзD طD DD D D0D 8D HD"`D hD xDD D D/D ȸD ظDAD D DT D (D 8DdPD XD hDvD D DD D ȹDD D DD D (Dć@D HD XDۇpD xD DDP D DкD غD D D D D0D 8D HD0`D hD xDCD D DYD ȻD ػDiD D Dw D (D 8DPD XD hDD D DD D ȼDՈD D DD D (D@D HD XDpD xD DD D DSнD ؽD DD D D0D 8D HD`D` hD xDD@ D DD ȾD ؾDD0 D D* D (D 8D2PD XD hD:D D DBD D ȿDJD D DYD D (De@D HD XDppDP xD D|Dp D DD D DDp D D0DP 8D HD`D hD xDD D D̉D D D։D D D D (D 8DPD XD hDD0 D D D D DSD D DD D (D@D HD XD(pD xD D6D D DBD D DTD D D_0D 8D HDt`D hD xDD D DD D DD D D D` (D 8DPDp XD hDD@ D DD D DʊD D DيD D (D@D HD XD/pD xD D6D D DD0 D DD D D 0D 8D HD`D hD xDDP D D(D D D0D D D; D` (D 8DHPD@ XD hDZD D DfD D DrD D DJID D (D0 @D HD XDpD xD DD D DD D DADp D D0D 8D HD`D0 hD xDDP D D|D D D8D D D Dp (D 8DƋPD XD hDܧD D DFD D DD D DD0 D (D@DP HD XDыpDp xD DUD D DًD D DՌDp D D0D 8D HD`DP hD xDD D D D D DD D Dq D (D 8D.PD` XD hD?D0 D DD D DD D DKD D (D[@D HD XDGpD xD DGD D DmD D DD D D>H0D 8D HD`D hD xDD D D}HD D DHD D DH D (D 8DHPD XD hDHD D DHD D DHD D DID D (DH@D HD XDÌpD xD DTD D DӌD D DD D 0D DDoDDDDDDDDDDD DD(D(D0D(DD D(D8DhDhDpDhDDDDDDDDDDDDD@D@DHD@DPDPDXDPDpDxDVDDVDDVDDVDDVDDV@DnHDדPD`DmhDpD DDD.D:DzbDD$DDED} DO D`(D|@D`HDx`D`hD|D`DxD`D|D`DxD`D|D`Dx DZ(D 0D|@DZHD PDx`DhD|DDxD^DQD|D^DQDxDeKD|DeKDx Dg(D~0D8D|`DghD~pDxDxDDDD|DDDDxDͬD|0Dͬ8Dx`DhD[pD|DD[DxDʔDBD|DʔDBDxDהDDޔD| Dה(D0Dޔ8Dx`DhDpDxD|DDDDxDDDD| D(D0D8Dx`D hDpD|D DDxDDhXD|DDhXDxD6D|D6Dx Df6(D|@Df6HDx`D-hD3pD|D-D3DxD:DHD|D:DHDxDMDD$D DE(D} 0DO@D'HHD|`D'HhDxDDD|DDDxDRD|DRDxDD| D(Dx@D+HD|`D+hDxDVD|DVDxDfDD|DfDDxD3D| D3(Dx@DHD|`DhDxDTD|DTDxD!DDVDWD@m Do (Di @Di PD`h XDm `Dpm hD@h pDh xDg Dp Dq DPt Dw D@w D0s Dv D r Dq Du Dq PD`y XDА hD{ xD Dy DІ D` Dy D0 D DPy D DP 0D 8DІ @D HDy PD XD `D D D Dp D D DH(D0D8Df@DHDiPD\XD`D4pDpDxDpDDDDD D0DDDDD0DDDP D0D`8D@D HD@XD`DxDDD0Dh`DxeDY`DNhDexDDWDxeDL Eb Ee E0Y@EjHEuXE EO E E;,E,Ef,E  8E(8E(f88ECE#4CECE`OEi4hOExOE0[E[EXf[EfE fEfE`@rEHrEfXrE}E}Exe}E YEE'E{ E?(Ef8EEKȠESؠE` `EihEpxE EEgE@EE@gE@EHHEhgXEEEEEEEО E|(Eg8E@EEgE` Fh Fgx FPFF hF  Fma FHh FE@,FH,FxhX,F 7F7Fh7FLCF7CFhCF@f OF(OF i8OF@oZFZFZFpr`fF@hfFPixfFrF rF rF}F: }FC }F @FsIHFiXF9FFiF F FiF: F` (Fj8FFl ȷF8jطF`Fy hF`jxF "F FjF@/F FjF@FvaHF XF/F FjF0;F FkF? G ( G0k8 G0DG GXkGpH` G h G x GI,G ,Gk,GPa7G!7G!7Ge@CG"!HCGkXCGqNG,!NGkNGxZGHZG5!ZG~ fGL!(fGU!8fGqGk!qG(lqG`}Go!h}Gv!x}GG!GPlGp@GTXG&`GThGTGTGTGUGUGTGUȠG$РG#UؠG(UGMUG*GYUG,UG, G8U(G@U0GLU@G`,HGXUPG`UXGjUhG+pGuUxGYUG|UG.GTGUG.GСGUG.G[GUG.G; GU0G.8GHGU`GpGUG.GUGUGUG$GUGVGVТG+آG VG4VG=VG 'GKVG`\GUV G'(GbV0GkV8GVHG@(PGVXGV`GVpG(xGVGVGVGP)GVGVG6WGp)ȣGWУG WأGVG)GVGVGVG)GW GW(G5W8GP*@GWHG WPG0W`GP0hGAWpG WxGWG,GWGWGLWGP-GYWGbWȤGwWؤG`-GWGWGWG-GWGWGW(GP.0GW8GW@GWPG(XGW`GhGXxG.GXG\GXG@/G"XG\G*XȥG.ХG4XإG]G:XG/GGXGPXGaXG/ GoX(GyX0GX@Gp1HGXPGXXGXhG1pGXxGXGXG2GXGXGXG2G YȦGP]ЦGYG3G!YG/YG:YG3GIYGTY GaY0G`38GrY@G|YHGYXG3`GYhGYpGYGp4GYGp]GYG5GYG]GYЧG 6اGYG]GZ G!0G\X8G!HG!PG!`G!hG!xG"G"G)"G6"GJ"GZ"Gp"ȨG"بG"G"G"G"G"G" G #(G #8G5#@GF#PG[#XGl#hG#pG#G#GlG#GlG#GlȩGmЩG#G $G $G4$G(mGD$Gb$(G$0G$@G$HG$XG$`G$pG%xG%G-%G>%GW%GPmGxmGmЪGmتGmGl%GnG%G%G% G8n0G%8G`nHGnPGn`GnhGoxG(oG%G &GHoGxoGoGoȫG$&ثG>&GoGpGT&Gm&G@p G&(G&8G&@G`pPGpXGphGppGqGHqGxqG&GqGqGqȬGrЬG@rGprGrGrG&G'G'(G3'0Gr@G(sHGI'XG`'`Gs'pG'xG'G'G'G'GXsGsG'ЭG(حG(G.(G?(GZ(GsGt Gq(0G(8G8tHG`tPGt`GthG(xG(G(G(G(G(G)G%)ȮG7)خGN)Ga)Gt)G)G)Gt Gu(G)8G)@G)PG)XG)hG*pG*G3*GC*GW*Gg*G}*G*ȯG*ЯG*G*G*G*G+G+G#+(G8+0GI+@G^+HGo+XG+`G+pG+xG+G+G+G+G8uG`uG,аG,ذG,G0,G?,G[,Gs,G, G,0G,8G,HG,PG,`G,hG,xG-G!-G6-GG-GZ-Gi-G-ȱG-رG-G-G-G-G-G- G.(G.8G!.@G-.PG>.XGK.hG^.pGm.G.G.G.G.G.G.ȲG.вG.G/G'/G@/GU/Gl/G/(G/0G/@G/HG/XG0`G0pG*0xG=0GS0Ge0G{0G0G0G0гG0سG0G0G0G1G%1G;1 GM10G^18Gk1HG1PG1`G1hG1xG1G1G1G2G 2G-2G?2ȴGM2شGb2Gs2G2G2G2G2 G2(G28G2@G 3PG&3XG;3hGO3pG_3Gu3G3G3G3G3G3ȵG3еG3G4G4G(4G94GN4G_4(Go40G{4@G4HG4XG4`G4pG4xG4GbG4GG4жGaG4G7(G5GsS G50GS@G5PGI`G5pGޒG*5G=G85G KG@5зG2KGL5G\5Gh5G' Gs50G@G|5PG&E`G5pG'G5G,EG5G2EG5иG\EG5GKG5Gm G50G@G5PG&`G5pGDG5GG5GG5йG 6G6G&6G46GC6 GQ60G`6@Gn6PG6`G6pG6G6G6G6G6G7кG&7G77GM7Gb7Gy7 G70G7@G7PG7`G7pG7G7G8G8G.8GF8лG\8Gq8G8G8G8 G80G8@G8PG9`G9pG&9G:9GH9GU9Gi9G|9мG9G9G9G9G9 G90G :@G:PG/:`GA:pG\:Gv:G:G:G:G:нG:G:G;G;G G(;8GXG3;pG=;GuGE;GX;GvȾGi;Gt;GxG};G;0Ghy8G;PG;hGypG;G;GyG;G;ؿGzG;G;G8zG;0G;HGpzPG;hG<G}G <G<Gp~G'<G=<G@GQ<G\<(G(0Ge<HG|<`GhG<G<GȅG<G<G`G<G<GG<(G<@G =HG%=`G2=xG==GZ=Gj=G0Gx=G=G=G=G= G`(G=@G=XG`G=xG=G8GBG>GG >G>G*>GC> GR>8G@G_>XGq>pG8xG>G>GhG>G>GG>G>G( G>8G>PGXG?pG?G(GAG'?GȖG1?GA?GGO?G\?0G8Gg?PGx?hGhpG?G?GȚG?G?GG?G}DGXG?0G?HG@PG?hG?GG@G@G(G*@G:@GhGH@Ga@(G00Gx@HG@`GhG@G@G@G@G@GG AGAGG-A(G9A@GHGCA`GSAxGGaAGmAGGwAGAGХGAGA G(GA@GAXG`GAxGAGxGAGAG GAGBGШG B GB8Gȩ@G#BXG0BpG;BxGMGTBGGfBGpBGGxBGBG@ GB8GBPGXGBpGBGGBGBGGBGCGGCG,C0Gȱ8GEPG>ChG@pGMCGWCGGMG_CGGqCGCGGC0GCHG0PGChGCG`GCGCGGCGCGGCGD(G0GDHGD`GhG'DG5DGGADGODG[DGmDGDGPGD(GD@GغHGD`GDxG@GDGDGGDGDG0GDGE G0(GE@G)EXG`GyJxGAEGXGHGLEGGSEGeEGGuE GE@GEXGEpGxGEGEGGEGEGG CGFG GF8G&FPGXG9FpGKFGG[FGvFGGFGFG GFGF0G 8GFPGFhGpGFGFGXGMG GGGGGGGG'G0G6GHGPGCGhGOGG(GYGGjGGGoDGyGGGGGG(G@0GGHGG`GhGGGGGGGGGGG`GHGHGPGH(G%H@GHG.H`G?HxGGNHG]HGGjHG{HGGHGH G(GH@GHXG`GHxGHGXGHGIGGIG. GG!I G2I8GP@G6MXGAIpGxGNIGZIGpGdIGqIGG|IGIGI GI8GIPG@XGIpGIG@GQGIGHGIGJGXGJGJ0G8G,JPG8JhGpGBJGMJGGVJGfJGGtJGJGGJ0GJHGxPGJhGJGGJGJGGJGJGHGJG K(G0GKHGK`GhG$KG0KG`G:KGJKGGLPGXKGbKGK(GK@GHGK`GKxGGKGKGXGKGKGGKGL G(G,L@GBLXG8`GVLxGeLG`GrLGLGGMGLG`GZM GL8G@GLXGLxGLGLGLGLGLGM GM8G$MXG2MpGEMGVMGjMG|MGMGMGM8GMPGMpGMGNG(NG2NGKG:NGKN0GXNHGPGcNhGkNG GqNGNG GNGNGGNGN(G0GNHGN`GhGNGOG@GOGOGG)OG7OGGCO(GMO@GHGUO`GaOxG GkOGzOGGOGOGGOGO G@(GO@GO`GvDxGOGpGOG}DGG?GOG'B GO8GO@G.JXG<pG8xG)DGPGGPGGPG'PG G0P8G=PPGXGHPpGXPGfPG. G GrPG; G GPGP0G8GPPGPhGpGPGPGGTGPG%GPGPG QGs<0GQHG'PG#QhG2QG)G?QGIQG)GQQGgQG(*G{QGQ(G+0GQHGQ`G+hG}BGQG,GQGQGp3GNGQG4GQ(GQ@G5HGR`GRxG5G"RG.RG8RGDRG5GNRGWR G9(G^R@GuRXG :`GRxGRG:GRGRG8;GRGRGR GR8G <@GRXGSpG<xG SGSGH=G$SG.SG6SGK G= GES8G\SPG(>XGBpGqSGAG|SGSGHGSGSGSGS0GH8GSPGShGJpGBGSGKGSGSGLGSGSGNGS0GSHGOPG ThGTG#TGmDGXQGRG/TG=TGMT(GQ0G[THGnT`G`ThGTGTGWGTGTGWGTGwDG XGT(GT@GXHGT`GGpGGGGG@GpGGG(G8G@HGPG0lXGlGGGGGGGGG G G(G G0G0G8G0G@G@GHG@GhGG\ GG0lGlGGG@G8G8G@G8GpGpGxGpGhG:G8G8G@G8GPGPGXGPG`G`GhG`GpGpGxGpGGGGGG H H(H H0H8H@@H@*D`HLpHOxHRHOHeHhHlAHhHHHHHHHH H0H8HHHPH|`HHH@HHhHHHHHH HHXH H(HjA8H@HPHXHhH pHHPHHH#H)HH-H6HH:HDHwHHHRH HV(H`0H8Hd@HnHHPHrXHN`HahH|pHxHHHHHHHYHHH?KHHHHHHJHHH.H|H HYK(H-0H68H@H:HHDPHwXHH`HRhHpHVxH`HHdHnHHrHHaH|HHHHHHHHMHHHH`?D!?DI?DQ?DR?DY?D\?D^?D?D?D?D7D8D8D8D8D 8D(8D08D88D @8D H8D P8D X8D `8Dh8Dp8Dx8D8D8D8D8D8D8D8D8D8D8D8D8D8D8D8D 8D"9D#9D$9D%9D& 9D'(9D(09D)89D*@9D+H9D,P9D-X9D.`9D/h9D0p9D1x9D29D39D49D59D69D79D89D99D:9D;9D<9D=9D>9D?9D@9DA9DB:DC:DD:DE:DF :DG(:DH0:DJ8:DK@:DLH:DMP:DNX:DO`:DPh:DSp:DTx:DU:DV:DW:DX:DY:DZ:D[:D]:D_:D`:Da:Db:Dc:Dd:De:Df:Dg;Dh;Di;Dj;Dk ;Dl(;Dm0;Dn8;Do@;DpH;DqP;DrX;Ds`;Dth;Dup;Dvx;Dw;Dx;Dy;Dz;D{;D|;D};D~;D;D;D;D;D;D;D;D;DD>D>D>D >D(>D0>D8>D@>DH>DP>DX>D`>Dh>Dp>Dx>D>D>D>D>D>D>D>D>D>D>D>D>D>D>D>D>D?D?D?D?D ?D(?D0?D8?D@?DH?DHH8BHtH5"1B%#1Bhhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhA%m"BD%e"BD%]"BD%U"BD%M"BD%E"BD%="BD%5"BD%-"BD%%"BD%"BD%"BD% "BD%"BD%!BD%!BD%!BD%!BD%!BD%!BD%!BD%!BD%!BD%!BD%!BD%!BD%!BD%!BD%!BD%!BD%}!BD%u!BD%m!BD%e!BD%]!BD%U!BD%M!BD%E!BD%=!BD%5!BD%-!BD%%!BD%!BD%!BD% !BD%!BD% BD% BD% BD% BD% BD% BD% BD% BD% BD% BD% BD% BD% BD% BD% BD% BD%} BD%u BD%m BD%e BD%] BD%U BD%M BD%E BD%= BD%5 BD%- BD%% BD% BD% BD% BD% BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%}BD%uBD%mBD%eBD%]BD%UBD%MBD%EBD%=BD%5BD%-BD%%BD%BD%BD% BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%}BD%uBD%mBD%eBD%]BD%UBD%MBD%EBD%=BD%5BD%-BD%%BD%BD%BD% BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%}BD%uBD%mBD%eBD%]BD%UBD%MBD%EBD%=BD%5BD%-BD%%BD%BD%BD% BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%}BD%uBD%mBD%eBD%]BD%UBD%MBD%EBD%=BD%5BD%-BD%%BD%BD%BD% BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%BD%}BD%uBD%mBD%eBD%]BD%UBD%MBD%EBD%=BD%5BD%-BD%%BD%BDfD HP HtRt*ALE1L8H5+Az0H= HHtH H E HXSH=Ht  HH=9EzHHtH5G3Hu E[H5}HtH5j)HuE[ÐH=EHEH9tHBHt H=yEH5rEH)HHH?HHtHBHtfD=EEu+UH=BHt H=xAdE]wAWMIAVIAUAATMUSHHXdH%(HD$H1$Eu AG\ 1LT$MtM\$HHk HD1EHLLATUARD$D$$茾 H Ņl$Ht-HD$HD$ CHD$(HC D$0CHD$HCHL$HdH3 %( HX[]A\A]A^A_L$gG L$&F L$ DLL$ L$H)L)1ɺ1H5%rf.LL$LT$L$HL\$HE1E1j11LjLARLT$ d H L$L\$tD$E1AcL1ɺ1H5}ff.fAWAAVEAUIATIUHSHHHI$HteHHtHHLHuNDHDHxHH[]A\A]A^A_fD1L!HI$|L1ɺ1H5H1%LY1ɺ1H5UDL11ɺ1H5-DL 1ɺ1H5"f.AWAVAUATUSHXdH%(H$H1HHLL9E1Ll$@L|$f.HEELHPPL@H1HHy4DHHHLH߅ u?H蟸1DH$HdH34%(9HX[]A\A]A^A_HL H߅tFQT$D$ OHHHLXH߅u9 1l@1Lg~1ɺQ H5e~1@3H߉D$ ǷD$ HmAL9D1L}1ɺq H5}11L}1ɺ\ H5}o1sAWAVIAUAATUHSHHHFPH6DH=EI迣HH1ɺoPH5`}1L ELdHY^HL-hL{A`<@HEPLLHuC'fHL9t-H{过 tHsI}HL9uHA1A麹LZH5zNXZH[]A\A]f.AVAUIATUSH0dH%(HD$(1XŅIM1L9tRI @HL9tAH{ tHsI}E11ALthL$1HL9uHA1ALNH5M5XZHT$(dH3%(u1H0[]A\A]A^L]M1ɺXH5VM@ff.HdH%(HD$1D$F@t!HF H@XHt51HT$Ѕt(D$t!HL$dH3 %(u4H1LYH5LT1[ff.HGPHH8ff.fATUHSHGXHH"H!r|1H9 u-HEHsHHxPIIHtH ,@HEHsHHxPWIIHtH GAD[]A\ÐHHHxPHIHt@\jHZHUHuLAą?LyK1ɺ1H5uKDHHHxPHIH@\HHUHuLAąLK1ɺ1H5J fHUHuL`AąLJ1ɺ1H5JTHH HCXH tL yHUHuLAą^L6J1ɺ1H52J>HHHxPFIH@ZHSHUHuL[AąLI1ɺ1H5IOf.ATUSHGX@uj ueH%IHt_HCPE1E11ɺHH8t?HuH H Ņt5[]A\fH߽cu[]A\HLJ IH5H1aI$3 2fH]HHCXIRUSHH $H1dH%(H$1HHHHH'1 H?H$dH3 %(u H[]譽ff.fAUATUSHAHHHHHIMHHA1HH5HH1Ht#uAHH[]A\A]@H t AE%A$LG1ɺs1H5G1LF1ɺe1H5F1H[]A\A]LF1ɺh1H5FOH[]A\A]fLF1ɺkAVAUATUSHIHHHEELLF1ɺHHAHDHELAAL F1ɺHHHEuY謽HA衴Et`L 8GH11SL9GH5E_XZ[]A\A]A^cHAHL FEuLuE1ɺ1H5qE [1]A\A]A^LIE1ɺAWfAVAUIATIUSH?WHdH%(H$1)$D$HD$L)$)$DŽ$Ht BHӉ$k IEXH.rH/rxCAE\ IEPE1HL$PLAH8 Dt$XALqHLPIAVmDL8CH)H HxG] tHQL HL e0RLoEP1H5CUXZH$dH3 %( H[]A\A]A^A_tL{ 0 Ly tDsED$(LOBIIHD$Mt+IHt*BHtH@@ ML;t$qHj/HD$HDLl$H$HʶHEHD$8HT$0DEVL1Et#H@IHЃ8KA9^LwIHtH$LPIHtH$L^IHt1҉LnIFHP€}AF1 rH@ H@pHa0IvpI|$D$HD$LH]A11HLDHH1HELaA11@H5]AHIF@I~]H1ɺFPL -1L1NH5A谾AZA[1WD 9;fDD{Eu0Lx t$IEP1H LHHx} SI1LHpHÅLw@1ɺ1H5s@ LxHLL QjDHp1҉LL@1ɺH5 @詽D$(q@Ll$LL|$HLLLЅD$HOT$LKH|$LjA1ɺXIH5?15 M6L;t$Ll$DL$(EJ ÅTLxH@L +LDH1ɺPLMH5!?1込_AXhfDL>1ɺ*H5>葼D$(@L>1ɺ1H5>aD$(v@L>1ɺ7H5>1D$(f@D$LIFH@ HxxP H|$H?IFHDT$8HX0HT$ ZHT$ 1L?IH5>1R\S读IFAXAYH@ HXx bHY1LӅuHD$@^Ld$ 1Ld$l$,Hl$0YL$H(LH1ɺUILKH5e=1i'XZ袯IFLLLD$HH@ Ppu1ɺl$,L =H5=Ld$ 誺D$(M6L;t$Dm\$(Ld$ l$,CD\$LE1D$(%DIvHHD$HHtI|$aHD$HH;t D$H%H߉D$LL$Ht$LHD$H8 H=H|$HD\$81H5;SIL=1t$ gu^_ 6IFHT$@tIVpHt$E11A L Ll$LL|$HD$LH|$LR=1ɺaILE;1ɺ5H5>;ݸHHHH$H߅$7L:1ɺH5:zD$( L:1ɺ81H5:LS1D$(Lp 8IML9!D$(L8Hp1҉LM9LM?LOLFIH5:1訷UI1҉LL91ɺH59iMD$(L;t$;f.I~pUL91ɺ1H5|9LZ91ɺH5S9D$(I~ZH1ɺLPL .L0FLl$LALH!H1ɺzIULSFL81ɺGH58gHofLl$LLE1ɺsIH581'-ff.fAWAVAAUIHATUHSHHHdH%(HD$81n uH0HEX HDKDSH :IEHDEtHEXL%:H%6EHH:HT$L=̫LDHL:HT$I1H57RATAW'DCH EHL蛼C$HHCAąH59Ll1 HHLAHL$8dH3 %(DHH[]A\A]A^A_DSHL$E1E1HLAą|$8EKt E\ T$ye1 lCHl LLM9ujf.M$$M9SI|$1ufDC HD[[L%8HELDH8HDATL%81SIH551\]A\AfDH$L%8H7LEt$LY51ɺ H5R5+@L151ɺ 1H5-5DzfL 51ɺ1H55蟲f.1H5HAą^L41ɺ1H54E1DH5 7L. /ff.@AWAVAAUIATIUSHHHdH%(HD$81 HAXtfH 3HQPH@uKHHH(g HCPHA$tHCXH)H߉ŅK H߅vl EAEAu A}HiH 5EEL=5L5)4H-mHDʅHLDLDEHL$HD<HL$L5 IH521QAWAVU芰H 1HHL$LŅL$tT$u D$(1Hd7H586L, LH*Ņ(H5!6L, LHLL?21ɺ 1H5;2կaHAPH@_HCX1 L@IH5111rHt$8dH34%(HH[]A\A]A^A_DH0C[uHhH@[LI@11 H5`1HhL@ IH5)11J@H0 L/?IH%HCPH@HAEI]()f.L31ɺ IH5o01DLA01ɺ 1H5=0׭H53LX* QH8 L>IH8H(HHCXAl$$1LH'T 9H߽LM2 IH5s/1 fDHL腴AE@L1/1ɺ 1H5-/ǬPfL =1ɺ 1A$?H5.薬蜤ff.AWfAVAUATMUHSLHdH%(H$1$$HDŽ$$$D$<蔻u8AH$dH34%(D H[]A\A]A^A_fD# t_D$H'H-0HEHD*H1ɺUIL0H5-1聫AZA[h$E1E1HHL$pHcADžDD$pD$tEt"t.H50HA& @fD1H2HCXH0H@AD$Y@HHD$HLLHD$ 1H5AX1AYL`] H5`1L91ɺ1H55E1̙HHE1%Ly, IH51~ffIw1ɺu ALH5AL1ɺ` H5~#UHSHH{t7HC@Ht.Hx8HKTtH{@HH[] DH1[]H uH fDL+1 H5lH HHz f.SHH dH%(HD$1HD$fJHD$H9t HuPHt$HtHD$HL$dH3 %(u-H [HT$H5Hf.1跏HGX@ UHSHHH9t+HCHxHuHCHxuHH9u1H[]fHCHx裱L) IH5d1HCH@H[]D1DUHHSHHR H߅uYHtYH+HH HL)UI. 1H5tH1[]#HuH6THKXHH[I11IH+]I,Aff.SHHSH1[HfUHHSHdH%(HD$1HGPH$H8t@HH5HÅt`HL$dH3 %(H[]fDHL2) IH51WDHȯH<$L HHt谯IH 1UL(H5eXZRG\ u tfDUHHSHHHGPH8tH[]DH]H[]DUHH5SHHD HLRHIHI[111]fUHH5nSHH H RHIHI[1ɺ1]ff.@USHHHQHE11I11HH5V H[]ff.fUSHHH{QHE11I1HH5 H[]f.USHHH+QHA1I11dHH5 H[]f.SH7tHCP[fHH HCP[fDATIUSH/H]H9t(Hf.HH萅HHL9u[L]A\fSHHHcHWHKH?H[6fDSH#HChƀH{X*H[fDAUATUSHHHLfTHFTIL$H3H3JH ~TIHHH=әEfHLCTAD$AD$ oMKToUAT$ŅH{HuEH[HL χMt I}h IAT1L)S@H5%0XZH[]A\A]@ID$IL$H3BH3JH t%@M1L )H5{%ѐH[]A\A]@LXH=Eff.ATUH-ASH~AH9t)I @HH9tHsHL茈uH[]A\1H[]A\fDHtSH4AL-AL9t8LLNHx\HHTL1L1H uHNH~H3HdH3xlH t HL9u1DSAUfATUHSH8dH%(HD$(1)$)D$D$ HooVIH=EL) $)T$HHHtLhHHL蔇HT$(dH3%(HH8[]A\A]f.H=AEHqHHtIu1L'H5#D1@HtٖE1ۅtHH|HHtԀKIL'11H5=#1葎 @~Et<$tHUH5#MAUL&g11DY^HH8ooOL AdH%(HD$(1L AD$ )$)L$M9tjIQ0MA0L9tUHfHBHHwH3H3pH u1HOHwH3HH3pH uH@HHT$(dH3%(uH8HL9uM M9u1菅ff.@H8ooOLLAdH%(HD$(1L 5AD$ )$)L$M9trIQ0MA0L9t]HfHBHHwH3H3pH u9HOHwH3HH3pH u$HHT$(dH3%(u!H8HL9uM M9u1DŽSHHtHt H{H4t[fDH{tHsHH=xEH9t&H=oEHsTH.H[DHsHH==Eff.HH=AEBH=ۤA6H=A*H=AHՓEHt8~HǓEHt"}HHEH1HfuE@-eEtf-ff.ATL%3AU1SH(AL9tH{HHL9u[]A\fEDHH9tH;xu @H9xtHH9u1f.HH=Au H@H=qAHAUATUH-@ASHH4AH9toII"HSHLHPHH9tEI|$趤HuѹL]#H5H1[]A\A]fH[]A\A]UHAHSHHAH9uKfDHH9t=H;kuHR@L)#IH5"1{HSH{H=9ELLL$L$AM1LH5IHsLsfDLsML g~H=ELL$%H=ELLL$AJM1LH5=i1ɺL$LqH5LL$L\$ LL$L\$L$qxSHH0HtH@HHtHt HH[[ff.ESHt.HHtYuHu?H{HpT[鱜H=qEHuL1ɺH5@1[@L1ɺH5HEHt#HHHt$HH=نE Hu1HATHfUSH0H=EdH%(HT$(1)$)D$D$ HHooPIHL) $)T$HHt~HtH@hH9tHu#HL$(dH3 %(Hu\H0[]A\HH{hH贔ATLUI@1H5}XZ1uSH1HǨHHtf[DH8LIH5 1a}1[ff.fSHHǨ1HuHt%HPHH9t;ZAL9tQfHPHHNHH3OH3H uHVHNH3WH3OH u HL9u1DSHwhHtH= EHt HƨHsPH'HsXH~HP H{X`H[kAWAVAUATUSHHH<$dH%(HD$81D$<$HLrLHHֹH=!D$HAH0Ht$(H5 AH9LD$L`HHD$M<$I9~HD$0HD$ HT$0HL9!HHH= €uIT$hH4$HR8HHHc H9KHH1ɺ PH5 1MULNt$H=wH H<$1ҹH0nIML;|$II\$hLLLH{IHCpHD$0HMHtHH= uID$hH $H@8HHHc%H9IML;|$g@HD$(HTAHH9t HT$(JfHD$8dH3%(9HH[]A\A]A^A_DD$H߅輌HHDl$fDHt$ H" H苌L 1ɺIH5c 1ufHXH1ɺ AUI1LUH5' AV{uc`H LXH<$1HHHP/DHMHDl$H1ɿPLH5 1Ut$H uH mff.AWIAVAUATUSHdH%(H$1H$H1@L 9H5; tH=jAH=NALi11LHHH=#AntZL @1H5tH$dH3 %(vHĘ[]A\A]A^A_fDH$L$HH$H$HH$L 1@nH5.sIHD$HH$HH$DŽ$DŽ$DŽ$DŽ$@LhHAH(H]IH9E1%fH ًAHIHH9HMtWHuLHƨjuLLILH H=AXDLL}LmIŨmDL,$MH<$111Ҿ$LHHD$W6LH3NVL $1ɺ1LzH5qHD$HHhIHcP HA8HL$HD$H%H9H\$LE1HuHIHIDHD$H$L9RD$0D$ Lt$(HLE1HHu MLHtxMLHHT$>iH ME謇LH衇H1ɺULH5rP1ATLL$ pH HH;\$(IHkHcP HE8H%H9,1HLHLAVLHfDH|$HD$H1ɿHT$ I1LH5RpD$@EXLEZHH;\$(I\$ Lt$(YD\$0EKM2LzATLY1t$I1H5JoAYAZHD$Ht HXhL9H$L IL9>H-HXHHI1t$I1H5,oXLZM1HILHPLc`M$$M9ufH蘅H|$H苅U1H5qATIL 1nD$0Y^IHl$H$H|$\ HL$IHihHcHE8H%H9 L91(fDHg HHL9X IHcHsHF8H%H9t1ҹL'uH,$11H%H$H LL`L $@LLh'H5;1mL$M9fL|$0Lt$x-H~LFH3xL3@I LxPHxXMiE1HD$fH|$0E1E111LVH|$0E1E111HމD$@VH|$HLD$D1mH|$HHމD$\ m|$ D$`3(|$(D$d&(t$8|$ D$hŮt$<|$(D$X贮HH=HDH߉D$l*LHD$pHIT$L% Ut$LH->LyVL$@QH$Qt$`VL$PH5Q@P1lH@MHH5=IEHt$(褂HL$LHD$ HHE苂MH5=IT$LDHL Ht$0LVHL$0H5:Q@UP1AWkH$HHt$PH0 LH$I HIT$@Ht$(L{ LVH5AWUH-P1t$xkH0D\$HHEHDHT$ 蠁LLINjD$IE脁Ht$ IT$L+ @VLH5JAWUH-P1jH D$`HHILEL\$ HeLINjD$\HDHt$ IT$L @VLH5AWUH-n P1jH D$hHHILELT$ 蜀HLINjD$dHD耀Ht$ IT$L@VLH5FAWUH-P1iH D$lHHILEL\$ T$XLIDžHjHDHt$ IT$L @VLH5AWUH-/P1 iH L$DHH!ILELT$ t$@HLIDžHD|Ht$ IT$L@VLH5BAWUP1hH H|$t[Ll[|$@DT$HE+HIM$$L;d$xI\$L9tH5AL)H5AHAƉD$D D$IE8H$LHHHH L$ HC8T$8HHHH L$( ‰T$<u HDŽ$H$Hzu HDŽ$ID$HHD$PH$H$H$H$ID$HHHtDL}HH(_H߅$}HH_$ID$Ƅ$`H$@o)$@oHAH)$PH9tEHJ0LJ0I9t)fDHAH>LFH38L3@I H L9uHHCAH9uE1HD$E1DL$EtNDD$EuDLHHDH5~ALH5~AH߉D$D$D$$ȃHP|$@ t$D LH)@+|H|$H|H1ɿHT$ I1LRH5RUAT=eD$@H pDH|$0LDH|$0DHHD$ϻIHD$HtLH]$MLL\$H$L|$0Lt$xH} L;hhL3{HH$Hxh{S@PLL$1LhH5DdH$_AXL9t&L;nufL9nH6L9uLzHLPLL$ H5f.HHozH1ɺt$I1LLH5=cAYAZH|$HD$HXhH9H$IH(L9*HXL,$H]HHyH1ɺAUI1LH5cXLZI1HILHPc`HEL9uLHvH$H{hoyH@L?PLL$+1H5;bL$LkhAXAYM9LyH@LPLL$H51:bY^H$L8L9I1HcfDLG1ɺGH51aHxxHHmxSL-1PLL$1H5?aA[[DL9aH'xH1t$I1LH5KaXZ@H$3YHH$H$HHQhHPKfD˼"L $LO11E1E1H5\`HD$fH|$Hl$H]hH3wH1ɿt$I1H5LQW`YH^DH|$HD$HhhHvH1ɺt$I1LMH5_AYAZH|$1HLIHPH$e`I\fL $LE11H5E_H$fDH=QxAH-H$H=6xAqH$L$H;$t\H{usIIH51@_HC11H@HtHHL9uH$H-;L$H;$tJf.H{guI@yIH5@1^HsLHL9uH$H=AwAL%:wAH$@L$ eHwAL5L9uaD1ɺaLLr^H{tHc1UIL1L]HXZL9HC@HLoo)$ )$0 ul@Ht$1LH\$LHIf9I1MLDLl$軸HH0H$H萷H{sHILQP@!H51 ]AZA[fLsH1ɺt$I1LH5v\U_AXHtLhH$HH$L9t&L;oufL9ovH?L9uHsH1ɿt$I1H5L4:\Y^H|$1HLIHPc`DL$DtT$@HBHD$PH$H9WH$H9FLH\HXrH1ɺt$I1LUH5&|[=T_AXHtHhH$H衵H$L9t&H;ouIfH9o6H?L9uHqH1ɺt$I1H5L4Z_AXH|$1HLIHPc`HhqH1ɺt$I1LeH56ZMSY^HtHhH$H貴H$IL9HZH9[H@H9hNHHL9uH*L,$I$L9L5Mf.IhLpIM1AWpH5eP1YA[A_HL9sHC11HIHtH@h@HLoo)$ )$0 eL1ɺmH56YAH|$LoH@H5PLL$1LXH$AYAZL9u9LxoHLPLL$H6L9tL9nuH$腳HHL$PH$H9uH$HH9$$ȃutHD|$XEtgDt$lEu]LHf.۲fD˲H軲H$IeLH:al$ltD\$XH>ED|$dt|$huLH3'O|$ht|$dH |$\t|$`uLH|$`t|$\tLH f.HH1HǨGHtHHfDHff.AWAVIAUIATIUSH8L$ H\$HdH%(HD$(1LL=HdLxHhI9u"}DIOhHHHH轰M?I9t]GHuֹLVH54V1HT$(dH3%(?H8[]A\A]A^A_Hl$H9tfDH}HmH9uLL{Ht$ML|11cH5\UD$ IHLt]8Lt$I.LI9t$[LI`HHHmH9uLLHtJf.KfLy1ɺRH5U11ML1ɺpH5T1Lf.1DfIHtHHLJ1f.AWIAVLrAUATUHSHH(L"MLt9H{PH{uLkPMLK`LE@fDLK`LE@LkPMt&I}HLLD$L $ LL $LD$LLHL(AŅuyM-1LH5DSH(D[]A\A]A^A_H~P1t"LkPM]H{ ,@LkPLLH&AŅDmPEu H}XDu`AAuDA9tqsƃAƇH{hT$H4$oiH@LOHt$I1VT$H54R~AUATAVRH0ADvƃDL{PMtAHuXUTBA9Q#MAI9u9tH{hL$T$H4$hAUL$MLE1QHt$1VT$ H5kRAVP1QAƇH0Md fDE1MPMLK`LE@D]TE\fDHCPHxH&~ D8@M61LJH5 Qj@MAH{hIET$H4$zgH@LHt$IVT$RvAUATAV1H58PHCPH0L]0HPPHM@LuHLm8D1H $DXPMHHtHLHT$QHHT$trHCHSPLHT$GHT$HHHRHH{hHT$fAUHT$LI@1RH5cO_AXMt}HCPLMtLLGt^LzBLkPLFIHMmHH{hfAV@H5AUILg16OY^H<$Ht|HCPLMt L3Gt`LAH<$LkPzFIHjMeHH{he4$LFATI@1H5[NXZI0HhLߨH]L#H9H`HLL¨M$$H9uAfD1L@H54NHC`LpHLH{PqMfAH{hIAƇET$H4$dH@LHt$IVT$RAUATAV@AH (HH{hHDHHHL\$HT$HL$dHT$LIH51RHL$Q@;MAYHCPAZL\$fHCPHxHfDMMLH5}LM1LH5VLMLH5,LL $LH5ZLAVfAUATLUSHoOhHdH%(H$1HD$(ID$8H$HG`D$HHD$0HD$XD$hoGxHD$@HL$Ƅ$HD$H)$)$AEL9t9H@H{1Hw@HtH}LHAƅt>HL9uAH$dH3 %(Du=Hİ[]A\A]A^f.Ly1ɺ1H5KCAVLA1AU@I7 ATH5qUSJH=REHt號HREH=REHt#H5[薣H=REjHREH=REHtNHkREH-LcAL%EcAH]HL9t$fHH谷HHL9uH=cAItUH=bAIH=bA-H5bAH=bAH=bAH=bAEu5[]A\A]A^@L\O H5CI@Lpt\I]pImpH9tL%fDHH9tHsHHLuM1ɺl H5:ILy1ɺh H5Iff.@HHcHwHjf.HGh HAWfAVAUATUHSHoMhHdH%(H$1HE`D$XH$D$hHD$`HD$xHD$pH)$)$$$oExHD$xHD$0Ƅ$Ƅ$H|$0)$)$HD$(L$8D$H芿HLPIH@LHD$HM:ML9IF HLMHD$ IhI9tHfHJHH;y@tHL9t*HHH9y@uHIIH;\$HIhI9uAHAt$HL$T$]HLJt$$I1VHL$ H5QT$01R FNEH PNELLIH|$ LI HHH;\$GHL$I9Ll$`fHCHx@HSHt]P@, LATL1H59FXZHH;\$HC1LoA)$oXA)\$HCHp@?IHsHxh\HL1 PH5r1L,@EAYH}LAZHT$(%MoMwM9ULDuMmM9Y^IGXH@L97IVH@IhHR8Hh8HT$THT$1LIH5i1R U=IXXZKLcIGXHlLx 1H=EEHL9IGhHH=wEE fF LFIGho HoS蔓$HD$PHD$HD$ Mt A}fH<$LLg/E111L 1ɺ 1H5I<f.HHNH3H3KH HVHNH3SH3KH @IGhH=XDEH@11H`HLHVHD$4LL$HIHD$IiLIAIFIohIG`My MOXLLL+fDAomAoul$(At$~@HR@L IH51A;o@Iٹ E1L H5;[HCHSH3AH3QH f.H=BEHqIGhƀIX-L-L1ɺ 1H59:Lؼ1ɺ 1H5E1k:fD 1L $LH58:L $L1ɺ E1LdH5:S2ff.HHGH`AQIH1APIHIH@HHHw 1HHHHw01HHHW`H HGpUHSH_ HHW HHt8H@HH11H 艼ÅtCH[]DH9ufHHH9uHBH H@1L1ɺ H5Y8H[]fDHؒcUHSH_0HHG0HHt@HpHHH1H H 蠼ÅtbH[]@HuH9tHH9t HHH9uHPH@H HHH Hw1L1ɺ H5a7H[]fDH;ff.AVAUATLgUSH_L9tWIIHL9t@LHA։Ņu1L1ɺ% H507[]A\A]A^D[]A\A]A^AVAUATLgUSH_L9tWIIHL9t@LHA։Ņu1L1ɺ2 H5Z6[]A\A]A^D[]A\A]A^HcAVAUATLg USH_ L9tWIIHL9t@H{LA։Ņu1L1ɺD H56[]A\A]A^@[]A\A]A^AVAUATLg0USH_0L9tWIIHL9t@H{LA։Ņu1L1ɺQ H5I5[]A\A]A^@[]A\A]A^S1H1HǨ訶HtH9Xht 1[fH@X[f.HHǨ11hHHf.HGXHGpHwpHGhwxGxw|G|HtH~fD1DHG`HXATL%8MAUHSH,MAL9ufHL9tx9ETuHH9EXuH{H觾uHCHfHEHHE8CPHE0EEPEE(oKTMoSdU 1[]A\f1ff.fHuLALnLAL9t1L fHHtL€tHL9u1Df.AWL=LAAVAUATUSHL-LAM9tYHIfI}H%A9sAI]MeL9t#fH{hwIH%9EsEHL9uMmM9uH[]A\A]A^A_SHHЫ1HtHH1҅‰[ff.@Ht'Ht"HH膫Ht!HDf.HfDH9EHtH9s H=9Eff.@H9E@H8ooNHdH%(HD$(1HD$ )$)L$H9teHfHPhLIHHH3NH3H u6IPIHH3VH3NH u!H|$(dH3<%(uH8HH9u1')Ht_HtZUHSHHAHHtI11HHt4t*u!;H[]1D1H[]AUIATIUSHHHHHtYHX Hh H9u'9f.HShHLHP荊HH9tI|$NHuH[]A\A]fDHIٹY [L]A\H5A]/UHHSHkHt6Hx Hh HH9tfD蛶HHHH9uH[]fDHLl [H5]h/UHHHSLHIަHt9HP H H9tH;jhtHH9t H9jhuHHH[]f.HL [H5].SHHH]Ht8HP H H9tH;Zhu H9ZhtHH9u1[fD[ÐL  H5^.1[f.WdH H*H,H*H&utH0@uhH;€u\HLuPH uDH&u8H?u,HQu Hc uHxH^HEHAHt>HNj@du$?H<HIHDHfDHH9H@ff.AUATUSHI@@4IhL#=4EHuA@ 4EHhAąHHHHpI IHMHhHkH' HnHHxEHRDpLHt$HH|$@UXZH[]A\A]DIHC1ɺ;LH5NLHH1+ǃ @L+1H51z+H[]A\A]DAI@1ɺ5L2H5LHH10+ǃrf.LY1ɺD1H51*H[]A\A]L)1ɺAL1ɺG1H5B*f.LQ0f.Lɬ1ɺN1H5_*Xf.AVAUATIUHH5KSHH0dH%(HD$(1HD$HD$yQHT$H5KH蝶ID$HxPHt$耩IHE11H1L*ÅXH5)H ÅHT$H5(H+ID$HxPHt$IHI$pH5H˴ÅMl$XID$LLM$hHhX Å\fH5HA$xI$xA$A$A$A$,t%HH5eHƴÅzA$H5RHt*I$H57H艴ÅmA$H5#H跶t*I$H5HLÅ`A$H5Hzt*I$H5HÅSA$H5H=t*I$H5HҳÅFA$H5"Ht*I$H5HÅ9A$ H5Hõt*I$H5ϘHȲÅ,A$@H5H膵t*I$H5H苲ÅA$H5HIt*I$H5HNÅA$H5HHT$H5H+HT$ H5HID$&H@PHt$HxCHt$ I$ID$H@PHxaCI$CL`HHHLATI6H5g1%_AXHL$(dH3 %(H0[]A\A]A^ÐID$HL`H}HL=IAT3뗐ID$HL`HOHLIAT?fL1ɺ<1H5/%Vf.ID$HHXH9L.SPLL$H5y11$Y^L`HH謳HLIATBDL1ɺP1H5$fID$HL`HOHLIATIfID$HHXHFL6SPLL$ +ID$HL`HHLIATVID$HL`HHLyIAT\ID$HL`H葲HLIIATbID$HL`HaHLIAThxID$HL`H1HLIATnHID$HL`HHLIATtID$HL`HѱHLIATzID$HL`H衱HLYIATID$HL`HqHL)IATID$HHXHAHLSI1H513"XZXHXHHHLISSHH dH%(HD$1_1 )Et%)EHT$dH3%(H [DHL$ LL$HߺLD$H5!)EK5)EtQT$ t!|$v)Ev)E@L)1H5$!@1R$@SHHw t [L1H5U [ff.ATIH5UHSHhLHPH1NHH5jLH@HPH1ÅpH5L1Å3  @HH/H!H5L1 ÅHH5L1ÅL͡1ɺ1H5c"L1ɺ1H5?[]A\Lw11ɺH5 []A\fDHH5L1XÅfH5L1!ÅL1ɺ1H5BHH54L1Å~NfH5L1Å'H5L1yÅH5L1IÅL1ɺ1H5Ajf[]A\@HxH5L1Å>fHH5L1ÅfHH5L1ÅfLI1ɺ1H5rf.L1ɺ1H5Bkf.L1ɺ1H5;f.L1ɺ1H5O f.L1ɺ1H5f.LY1ɺ1H5f.L)1ɺ1H5R{f.L1ɺ1H5"Kf.Lɝ1ɺ1H5_f.H11?e#EHff.@UHHSHHHHgHHC(HHHCH3AHC rŅt3LK(1L1ɺqH5'H[]1Lל1ɺpH5oH[]fD1L1gH5:H[]Ðff. AVfAULATIH5k;UHSH0dH%(HD$(1LAEAE AE0HD$HD$HD$HD$ HT$H5:LHE\HxPHt$IH2E11H1HÅHH5L0ÅHT$H5L袥ÅH\$H HAH޺LHH5(L;ÅqHH5?LÅHT$ H5LHE_H@PHt$ Hx5HHoH5L螦PHT$H5L¤HEdHxPHt$覗IHH5LKt HH5LQÅmH5ELt'HH5+LÅhH5Lޥt'HH5LÅ\H5L褥t'HH5L誢ÅPH5Ljt'HH5LpÅDH5L0t'HH5L6Å8H5gLt'HH5MLÅ' H5CL輤HELuXLHHXMtIMXHLÅ>@HhHLԤHLUI;1H5$XZHL$(dH3 %(H0[]A\A]A^HELHhHnHL.IU8HELHhH@HLIUFgfL1ɺA1H5{Tf.HELHXH>LSPLL$H5311AXAYf.HELHhH萣HLIUZfHELHXH`HLHISNzfHELHhH0HLIUKWfHELHhHHL(IUU'fHhHLԢHLIU_E1HELHXH螢HLISbHhHLtHLIUhHH5WL耟Å@HELHhHHLIUpAHELHhHHLIUwHELHhH辡HLIU}HELHhH萡HLIUHELHhHbHLIUHELHhH4LeWIU`HELHhH L<VIU7L[1ɺ1H5M&HELHXH輠LUkSPLL$ HELHhH葠LQIU SHH.7t [L1H5B[ff.SHH dH%(HD$1  5E+EtHT$dH3%(u~H [ÐHL$ LL$HߺLD$H5 .E$Et9T$ t|$wL#1H5vfD1rt@ATUSI@@ IH1LHHpu Lx1ɺ IHHHtH1Ht HHHHtdDH|$ LL;Å[]A\Lq11H5[]A\Ly(DL$H511GDL1ɺ01H5{`f.ATIH5UHSHLH@HPH1RjHH5L12ÅHH5YL1Å~H5L1Å5H5L1θÅdHH5gL1謸ÅHHtHPHH5QL1聸Å BjHH&DL1ɺ1H5۾ []A\L11ɺH5M []A\fDL1ɺ1H5{ D1L_1ɺH5S []A\L91ɺ1H5+ Kf.H57L1ÅiH5L1Å_H5L1蹶ÅuL1ɺ1H5z fH5ɾL1oÅ9L>1ɺ1H50 PH5L1'ÅL1ɺ1H5 Lɍ1ɺ1H5_ f.H5L1诵ÅPA ff.UHSHH[ tHHH[]fDH1[]AWAVAUATUSHdH%(H$1IL$PHtIIPMB uTL11ۺwH5>H$dH3 %(H[]A\A]A^A_IPH1ɿLҷHH5XLJHpH{1IXZ?|A`H$IIL@^IEu!LB HHH$Htkb %Ht$lLI~D$l!H $LIH51I1HHp^ HD$H-IM @^MuI0:I~17LsIH51MI~T$HLpT$I1H5RKA[XL{1ɺH511I~$HLT$IRH5H11AYAZfI0II(MHH9INfHT$pH)$H H5)B0)$)$)$HDŽ$HB@HIP)$oIhoAxI8)L$pH)$HDo)$oYI@)$H)$HD)$o!)$oiH .)$HD$ HH$H HH5ɯHD$(HE`EfHXIPHL$HD$HHH5rHH cHL$PHD$H@HHKHn@Hl$8ILl$@IHH\$HHLHDHD$0HL$XHHM/Hl$0Hf.HHuHLuMMuHl$8D}TI0I(I IH\$LHLELD$HWLVQRPt$Ht$HLL$HLD$hHL$`HT$@H$$H@Å\@I~Ht$1HL$H$OH$LdzI1RHt$VH5AWHL$ QH N@I1HWZ HD$ H%I1HHp4Z HD$(HLw1ɺ1H5%HHL=ISH\$HHt$1Hl$8Ll$@H"HD$HHL|$0Hl$Ld$0Ll$8Ll$XHD$HhHtDDH]MMLIIt$H~HuHmHuHl$E`Ll$8Ld$0}TI0I(I IEIPH\$f.He}TI0HD$I(I H\$IL v1ɺ1H5\Lu1ɺ1H5y6H|$H5HAHD$P+Lu1ɺ1H5#Lgu1ɺ1H5oHE H1ɺSL1H55p1SLL$pH H|$HLLt1ɺ1H5CLt1ɺ7HcH\$USHHHPDHEtLtTH[]@ǃHH{ H1ɿjI1H5TLeL^_uǃLH-H{H1 Hl1UILӰ1H5XZH[]H-HPH H1ɺ_UILH518AYAZff.@AVAUATIUHH5MSHHdH%(HD$1[1H5H"zHID$HHxPHepIHH5,H Å01H5HyHID$HHxPHpHE11H1LÅ=ADŽ$`H5aH~Mt$H5^I~HI^XHH2HHLHDI^XSÅH5NH:~*I$HH5/H;{Å6A$HID$HHXHa~E$HSLH5æP1S[1]GDID$HL`H~HLATI1H5zXZHL$dH3 %(LH[]A\A]A^ID$HL`H}IٹLATPH511A\A]DH5H|I$H5ɦHzÅI$ H5HizÅI$(H5HHzÅ9I$0H5yH'zÅHH5iH^|t_ID$ H@PHxcI$8HHH5+H`zÅI$8H4$j ÅH5H{ImX4 fID$HL`H/|HLIATHXHH|HLISNfDLIo1ɺ1H5Qf.HXHH{HL4ISfDID$HL`Ho{IٹLHATPIGE111LL*GÅ50fDI$`H5]HwÅID$HL`HzHLIATL!n1ɺ1H5)fID$HL`HzHLIATeLlH ID$HL`H:zHLIAT ID$HL`H zHLjIAT LTm1ɺ,1H5\ID$HL`HyHLTIAT ID$HL`HyHLdIATjID$ H@PHxI$@HHH5ʢHvÅI$@H4$ g ÅID$HL`HxLf!QIATID$HL`HxL;ARIATID$HHXHxLǬASISID$HL`HnxLVIATYID$HL`HCxAPILAT-ID$HHXHxLWISfff.AUATUSH8dH%(HD$(1HHxHIHH5KLHPH1.ÅtpHH5LH@HPH1Åtr`H@^HL$(dH3 %(H8[]A\A]DLj1ɺ@1H5'DLij1ɺA1H5qDLAj1ɺ>1H5I1bH5ZL1/Å1Li1ɺD1H5!HH5L1ÅLHÅHH5L1誑Å H H5L1舑ÅH(H5L1fÅH0H5L1DÅH8Ht8I(Lb ÅLH5tL1ÅH@HH(Hb ÅtHH50L1踐ÅLh1ɺZ1H5LYh1ɺL1H5a|f.L)h1ɺG1H51Lf.Lg1ɺJ1H5f.Lg1ɺM1H5ќ_Lg1ɺN1H59L}g1ɺO1H5LWg1ɺS1H5_zL1g1ɺY1H59TL g1ɺT1H5.ATIH5qUHSHLH@HPH1ҎtvHH5=LHPH1貎ÅHt"wqH5L1膎ÅLHÅ[]A\L/f11ɺH57[]A\fDH}/HL7SI11H5XZ[]A\1Le1ɺH5O[]A\Le1ɺ$1H5(f.LYe1ɺ1H5af.AVAUATIUHH5SH/qO1H5HkHID$HEHxPH9bIHeH5?PHpÅ1H5$PHkHID$H"HxPHaIH:H5HptGI$HH5Hm0A$HPuID$HhX;@HL5Å+LL;ÅFLL;:ÅID$H<uQLGDID$HL`H5pHL%ATIH51(Y^[]A\A]A^ID$HL`HoIٹLXATP1H5J1_AX[]A\A]A^DID$HHXHoE$HSLUH51P1XZZID$HL`HOoHLIATHXHH$oHLTIS6fDHXHHnHLISfDID$HL`HnIٹLATPL b1ɺ1H5tf.La1ɺ1H5oDf.La1ɺ1H5?f.ATIHUS;LHHHߗLHC(H@HHC@@HC 6ŅLK(L11EH5HRHHtrHJHC HLHC(H@HC 16ŅLK(11LmSH5[]SDA\@LI11H5T[]A\1L`1ɺDH5)[]A\1L_1ɺRH5[]A\ATIUSHH+H9u %@HH=8HC HHPhHEI9u[]A\fAUATUHSLH{HIHzHI9tDH{zHL9uL'7Ht=Hp{Hc{HL H M,$LI9uefH3{HtHVzHH+1[Lȣ]A\H5A]Jf.It L90t0I|$ yHHID$ H7HH IMLMI9u@H[]A\A]DHczIHHI9u#LpyHp6HL9tL9kuAVI1AUATUS螦H5HX HE1L-k@AH[HtO;uVHkLHH5HtH5HuIH[AHu[D]A\A]A^MLƢ11H5 sH5HQu AP@H5H1uA0@E1[]DA\A]A^ÐH#1MULz1ɿH57XZM E1LɡH5VSHGxHt"HH'yHtH[yf[fU1ҾSHH{HHHHt#HVÅtXH[]fH;8SHHH3HH t3H1LrH5RH[]LA[1ɺ1H5%1UL51ۺH5,USHHbH1Ht$H{pH2HE8HkhHk`HxH[]ff.fATfLUHSH`H) dH%(HD$X1H) D$H\$ HT$(HvW H<$HT$0H'HD$ HT$8H! HD$PHT$@H  HT$H(fH@8HLH1HHt1HHu1HL$XdH3 %(H`[]A\fDIHLt tLH#O tLH$tLHu Åt&LHtLH13tLRY1ɺ1H56Nff.ATIUSHH+H9u %@HH1HCHHPpHEI9u[]A\fATIUSHdH%(H$1HHupI<$HsAI$HI<$HpI$HH$dH3%(HĐ[]A\DK18HL ZPHsLZPHfH5P1H fL,H5nOfLԝH5>D@UHSHHH?\Lī1ɺIH5H1H;H H衧t H[]@I1LH5H[]ff.AUATIUSHH>t}11lHHtlI$M$I9u AHL9t9HSHL~uLyV1ɺ1H5]HH[]A\A]ÐHL1H5%DAUATUSHH.1ҾHǗAąE1D% 1ҾH貞HHX L-OH|/1H…u!HLHHNH9t2IL11[H5QE11$ HkHŅH[H;HkEtHHS1HYD;; fDLT1ɺ7H51eH[]A\A]H[]A\A]fD1Lw1HH5`H[]A\A]DLK1cLH5&H[]A\A]Lɚ1AH5:ff.@ATUS@H1Ҿv萕1ҾyH߉Pې1ҾxH߉ʐ1ҾwHAHDPDHH]Ņ1ҾtH1ҾuH߉T躊HTHHP_Ņ[]A\f.L1ɺ1H5ݦH1H5^HE111H5][]A\@1L61ɺH57[]A\1LwR1ɺH5][]A\LIR1ɺ1H5-f.LŦ1ɺ1H5f.AV1ҾgAUATUSHH@dH%(HD$81蕓D1ҾkHɎ(l% % 4r 1ҾeH蓎0xE 1ҾlH1ҾH1ҾnH:HpH軿11b! 1Ҿ|HÒ< 1ҾjH角1ҾhHAEHHtx1EH@71ҾoHhѽ1ҾqHbH(L` 1Mt~L54DMd$MtcA<$Ml$LL蘾H5L聾tH5cLnMd$Muf,1A1LtH5v,# HtrH HksH1ҾiHVH]Hh E1HtaL-5ML11gH5*HmHt#}uH}dHmA HuDlDH\$15H|$HHD$11IٺD$(LH5ZH莽HD$8dH3%(UH@[]A\A]A^DL1ɺ71H5EfH51L葼uEDHun1ML1ɿH5XZfDH50L9t5H5G9L&ur ]f.fD;fDH=y1ҾfH)@H56L衻tH5UL莻uJ@̀@1ɺaE1L LcH5fH5L1t%H5Lu"R@DH5 Lu MLؔ11SH5TL0H5(5AW AVAUIATUSHHrHtELpHMt9A04HLrLuMDH[]A\A]A^A_fM&1A<$@IL, ÅInHAH] H|L} H=NLu@u @IH{tAH[HuE1D LH=HmHjEtLLEÅMvMI~ ufE1M01LZH5o!LjJ1ɺa1H5N1fLJ:H5LJ1ɺf1H5CILgÅt=ADž0M[1LrH5YLI1ɺP1H53ff.ATL|-UHS>HuHLaHEH@HlIپH=iD1{LxvH}?IHtOHH=(DsmID$HtaHL ;uuID$H[]A\DLɑ11H52[]A\1LoH1ɺH5U[]A\It$H#Åt []A\ÐL)H1ɺ1H5 Vf.S1Ҁ@Hu!1]HHtI[H5TÅu1LG1ɺH5M[fL11ۺH5hAUL ATUSHH I9t[IfDHL9tHHs1LŅu1LG1ɺH5H[]A\A]fDH[]A\A]fDUSHHt>Hu9L1ɺ>1H5H-AHH[]HH%H}HpHHHH' }tC H=HuL1ɺO1H5zIL11JH51LDLI1ɺC1H5g!fAWHAVAUATUSH8H<$Ht$dH4%(Ht$(1HD$Hp8gH|$H511Ll$ Ld$螽HHcfH LL譱HL|$E7Et!H@IE7EtIDA uA#tHt;uWAt <#Lu/#t#HuH<$LHd@H<$LHILL$L11rH5aH|$Hu&HH\$(dH3%(H8[]A\A]A^A_L D1ɺ1H5LC1ɺ_1H511ۋ8AHb1PLL$1LH5VXZRZf.AW1Ҿ}AVAUATUSHHzH1ɺHH&HH1Ҿ~HH߃ 1҈H߃ 1҈资H߃ 1҈芄1ҾH߉L%z1ҾHHGzD(HEL5DIE1({IHDH@IIE/EA%uAGHG֑IH I~@Adž0 AA EAA AHI#H>II~pII Ik/葉Eh~I@HHߺH.LFA@H=菰IHH=rIFHH=TIGHL<LLIL5A@tH5LLILIH0LhXL(1Ҿ!LbI@"H"IHy1ҾLZLL L2L LԽLD kLLLIG{u1谒HhAGE1D$ EtLpAIGAo(Ao8AoHAoXAohAAoxAAoAAAAA}H80L\jH5GkLj1H5(kڔD1褈HHH9 IGH11虊u ߋ8 tZ11|~Ht@H@H5&H芗-IGH;1ue8 1H|@H5HIGH;H]g8IL LjRPHlPAQH5i1TH H/etc/lvmLI@Ck%1LjH5MiAuLf.LE155LhH5i辒fDAtHL[]A\A]A^A_@L1ɺH5hyLxk1ɺqH5hQ7@L1ɺH5rh)l@L hH5GhAfLf1xH5h̑L 1ɺH5g衑@L1ɺH5gy@L1ɺH5gQ@L1ɺH5rg)l@Li1ɺH5JgD@LA1ɺH5"gِ@L1ɺH5f豐@LeH5f膐L1ɺH5fbL1ɺH5f>L1ɺH5cf]L^1ɺH5?f9L:1ɺH5fҏL1ɺH5e讏L1ɺH5e芏89HL ЅPHhLePAQL1ɺ H5we.qLr1ɺH5Se MLL>1ɺH5e֎L1ɺH5d貎f.fDHg@Hg@Hh@H%h@fDA9AWH@AVLcAUIATIUHSDÃHDy K HHщAAtvtrML$Hh7LEH4IcHH "DT$ HDHH)LPH*1zY^DT$ A…xHHD[]A\A]A^A_fDAtzuvH΃L |IE1DfDKHHɨ@At$HL$gLLH511AEE1XZhHXML$I @UH@1SHHLԅHH"H=DHytH{HH5dD[]ͩDHHIR1Lf H5XH1[]ff.@UH@1SHHLH!H=DH8ytH{HH5D[]-DHH[IR1LFf H5踋H1[]ff.@UH@1SHHLJH!H=ADHxtH{HH5$D[]鍨DHHIR1Le H5@H1[]ff.@AWIAVAUATUSHHH9t?IIA @HL9t(H{LŅuCD9u.I@IH[]A\A]A^A_H@MLOeB4H54º1SXZff.@AWAVAUIATIUSHHR L$dH%(HD$81@KID$t1H4HlHD$ HHD$ 8#HD$H1HD$0HD$(HE}HD$HEHD$I+x#LMwz|LLH#LIHuLIHt$HHD$HtLpHID{HUHFiISI}Ht$#HD$0HIFADLxHH\t$HzHL$8dH3 %(HHH[]A\A]A^A_@BusHt$(H|$ HuIFuFHD$08uLeb1H5 1H[]A\A]A^ÐHcUtLuH5R@ LuȃLHHHcTuH[]A\A]A^Ð9u@uA $*W+/XfDHAufI9D$3CfDAA\D$ 1T/HAHEft1H;f.HIt$H|HsH;HaIIHAEA9$u(LHLHuMmMd$MtMuHS1M LHzD$ D$ tC1H;Uf}0ft1H;UHffuHcEE1L01ɺH5ȃ1AWIAVIAUIATIULSHIpHHE1ҋEC(AEtuHE(HtlH{ E!} HGt!HCMI|$LcMtI_HH[]A\A]A^A_DEuQ H ɱHcH>LHC H3A}/,fDA}xуI}HLHHCHC MCH[Jf.T$ I}H{ T$ fH{ HEE!HHH xHDHGH{ E!EGDH{ M HcEHG EoH{ E!tpT$ I}1UH{ T$ Hj@HC 1)Lq^11ۺH5rJ.DI\$fDHcE T$ I}1UH{ M HT$ 3T$ I}1UH{ T$ fDT$ I}1H{ T$ LY]1H5Ě蜀LY]1ۺH5lPAUfAATIUSHH8dH%(HD$(1H<$H~ HZ)D$HD$HD$ HD$H{ HHt$HH$EtxHHD$HML,]1P1H5ęXZH<$Ht Ht$,H{ aHD$(dH3%(H8[]A\A]fHtkHD$HML1PfDLd\H59H$H5EtH),fDHvf7HdH%(HD$1HL$HZt$HT$dH3%(u4H1L1ɺ H5g~kvff.I1@HHHc:HL tNtJ f.Et+DHHtDȃA ufø1fDSH:HHHCHt[D1L:[H5}1[AH]H1EDH A f AAwjt HfD1LZH52}1HfDAWAVAUATUH-5SHHc_(H4$dH%(H$1H HYHD~XHBIՋP tII tvH L%#@D$ HLQ0ft1f;P@lj|$ @0uM@H$dH34%(H[]A\A]A^A_DHPu@L@AWAAML H{ EM(LS<1ɃH5ʌ1E1rC(fDML@LH4$H4$A EMLSXH5Y<HAt$1Ƀ1rA[[>@ H{ F TfEL $fDI(1M9LA#ADHEH IHEM3LR<1ɃH{ L HLEEL~TH5P<H11AVqXL^Z1ɺIH51E1pH{ HxL LDELSH5؊<H11AVpAYAZL1ɺFf.EMLRaH5<11E1MprM L9N@1LHfD H{ HL 6LDELiRH5<H11AVo_AXfEL 9OEH5L ωLbR<H11AV^oY^AWAVAUATUSH(Ld$`D$ MtNH<$MMHHIHLMMATH|$HH~^_I|$ t$Md$MuŋD$ H([]A\A]A^A_IcD$(H5L@HHD!uHًH!%tDHQHDʉ@HHH)HL$HL$`aHMLAt$HL$ HTH|$I)MHZY=fD$ 'AWIcE1AVIAUIHATHE1U1SHv@HH8H|$HT$ HL$(HD$AD;kcAFt C Pt C BAN}H=HcH>f.S  Avf9s"tC0ft f9X Mf.LD$HL$(LD\$HT$ H|$/D\$HIucLP1QH5lH8L[]A\A]A^A_@AVf9S"rEtC0ftf9s3Mo{}H|$ILLLHLEHHPH{냐AVf9S"uIVHtX*uC uÃufDAVf9S"dH|$ELLL~ LwL8O1H5ӅkNfDAWHAVAUIATUSHHRLcg(dH%(H$1D$B KL5ۆ@HL { @ftHBHtZB tSHH5UaHL$?aHL$HHI}IL1H .aHZH$dH3 %(Hĸ[]A\A]A^A_DkuL|$ AHپLŅIEh@@t {"Ht$Ņ[IEhƄ$1@tKKHMd@Mt9L\9D$}+HT$H$LIE$hfD@H`HH„ L$H5_LTQI}LP1RH@VYH HBB KH5ф@Ht @ftHBHnB cI}1HP^YBfHD$H _H_&L1ɺ71H5ׂhf.L _LM@LCfDL1ɺ51H5WhfI}HHхHL$HHHOI}IHLH1)XI}H蘂C_ff.HS1HtHAWAAVIAUATAUSHPHHtkHx(zHHAu`H{ ZIHDxMtH{L艄IEHt8LmDeHHHH[]A\A]A^A_AD$w@LӁH5 ffDH1f@LJ1uH5Ԁff.LJ1{H5|ff.AVAUIATUSHHdH%(H$1HŋtePv]H6?E1L LVJ1H5eH$dH3 %(D]HĠ[]A\A]A^ÐHHLuHDIvH_AąC%=t7MN1LuH5oeAFgfH}HHC0AFIHt AM6IFIE)@MN1ɺLH5 AdfK\8YMNH @[HLb;H5~A9HDHE1PHP1RdAFH \ff.@AUATUSHdH%(H$1HË)HkHuHLd$Lf]AŃbD$(%=HL諩H$H9C}LM1LhI1ɺH5}c{kXLMH ZHIL):H5}A9HDHDPHP1RacH D1LHH5^};c1H$dH3 %(Hĸ[]A\A]ÐH?LGL H5 }1b1DLM1L)HH5|bZ8EULMLG11H5|hbHD$H9CtHD$@H9EeHZHtgSHu?H@Ht>HxHt5u,LE1ɺH5|a vH[Wff.@USHHHt$HHt9(t H[Hu1HH[]f.AUIATAU1SHHHu %@HHHtD9 t#HCHHuH1H[]A\A]HCHt'HEIHCHH[]A\A]fDIAUIHATIUSH$Ht_HX HHtHH[]A\A]D8tI|$8\~HHE Ht$L`L(HH[]A\A]1LE1eH5@z`fDAWAVMAUATIULSHH$H|$HL$HD$dH%(H$1CtlPvdH?E1L LE1H5y_H$dH3 %(DFHĸ[]A\A]A^A_fDAD$`tH$H$LHWIHHt$HLLE1_ H$uAD$`H|$DK,7LϦLt$A֋$HA9$LE1BuH1ɺDt$I1H5xLPEf^Y^LLQLWIHE11MTLK/L)fDLtHHމKOHcЅ[U8tԃ tRLHHtL8H2THDE1otHIHxUPL04H5w1S]H LnP1E1LCH5zwR]DIM9 LAD$`QAoAoOLl$ AoW Ao_0Aog@A/)D$ AooPAow`)L$0Aop)T$@)\$P)d$`)l$p)$)$@PIUH01!fD@{t tHj@t HDN tHLD SAŅLsH1ɿt$I1LB6H5Wv4\_AXH|$DK7LϦLt$A֋$HމA9$PD$Ao$ILH|$t2AŅu2L1ɺO1H5u[&eAŅt/AH$K 7HLlL1ɺR1H5Vu.[1-Sff.fATUHSHdH%(H$1HD$]HT$Ht$HIXH|$HMd$It$HHE11ɺjHjjjjLD$pjH0AD$H$dH3 %('Hİ[]A\fL1ɺgH5Gt1Z1|cID$HtzH ÅIt$GfDI|$ft"ID$]@OfDL1ɺH5sYL1ɺq1H5sgYfI|$bL11ID$vH5Os,Y2QfATA1HUHDSHdH%(H$1+HH'HHRuJ%P8AAH$dH3 %(HHĠ[]A\fD1ɿ1ILsH5r\XHDuILsH5Sr+X]fL}IH oNHHDHL.PH/H5qP1RWH H1DLr1H5qWOf.HHPH@HfDHcE1H Hr@HHff.@UHcE1SHHdH%(H$1HHr@HHHHЋHHHH$dH3 %(u HĘ[]NAWE1AVL5.r@AUIATIUHcSH\HLHHdH%(H$1IL{t'M1LH=H5Op'Vs I$L#tOHDHI1AV @t'H$dH3 %(u}HĘ[]A\A]A^A_ft[1LAVHTHIAV @ut1LAVLLDAFLL{fAFprMfAWAVIAUATUSH(HL"H|$HT$HD$MMl$I4$HHtdI|$HHHL$Lx H Mt9A?u#Iw<@uFHt H'uwMMufDMMdLH|$HHt(Ht#HKHPH9@@t o@CH([]A\A]A^A_fDI4$H|$IH^I\$HuAoH{ t"IH3}HLC t;L@ LM3LcuH3H=YufDM H=L€uH3 H=a|€t\LH=y€mL H=q}L€tLH=%L€0L fDHHQHuHP HQ IGHH@HCIGHXfDIHH@ID$IL`IT$HH2L!LLJt0MI1LIItXLIɅuML$LHH2I_HC(M&ID$KHJHHHH9K@gff.@AWAVAUAATIUHSLH(dH%(HD$1HGH$Ht$HD$HsH5AHIKH$H1MLl1ɺ|H5Hk QAD$BbH}E|AEIALd0fLH5?HHL9tMH}H3AHuL LR?1HE1H5j~PL9ufH<$HtHi@H;8t 膒HL$dH3 %(DH([]A\A]A^A_ME1LkH5 jO-Hh@L5UkHH$fDH $H= 7vJAD$H $gH=:NJH}EHH5g?AŅA@L1ɺ1H5_iE14OF8CA>MH wEHHDHE1PHsL%PH5i1RxNH ~@M1LHjH5hN,FAWAVAUIATUSH&IH7HGj@AE1E1 DHPAAhu-AEtA tLLLLHt MILDuA}M&tHL[]A\A]A^A_HHtzIEI~H0HHI}1HLOt H3롹L<|H5gMLE1HgLX<1rH5kgCMLE13L;1\H57gM L><wH5 gLdAVAUATAUSHdH%(HD$1AD$HH>I/H*CHHubIIDHLHcH$HDcHL$dH3 %(HH[]A\A]A^fDIL<11۹H5fKDLg11ۺH5eK{DH?1ۺB4HdgH5ePL @gL';1KY^/fILDHH TH$HuRI}(%iHH$HD`I}HUhIH4$HCHJH$BD9H?HL:4N 1H5dJXZ^L1ɺH5dJ2L1ɺH5d]JLI[]A\L91 H54c IUHuH?LdL H5b 1HH} XZHE ff.@ATIUSH~ HCLT:t%H5|b11PH[]A\fI$HtyttH8HC I$IH{ L[]A\@ŅRL"1ɺ1H5aGcLeL$8tgHs Hc덐I$Ht)]LY8f.LeL8uDL8fHt~uHHt1Ð[ff.AUATIUHSHHdH%(H$1HcHE1AHH5b@HHHЋHLHH=HEtMu(H$dH3 %(Hu!HĘ[]A\A]@At$HD>@AWLcHAVIAUATIUH-a@SKHHHdH%(H$1Ll$E1HپLD$ 臷{ t'M1L7H5_Es I$LKtnH1HE @u H]D$ tMu+H$dH3 %(Hu}HĨ[]A\A]A^A_AvLf.H1HE @uHUt LLHI$LHsLLH`s I$LfKtvH1HE @tMD$ tMu0H$dH3 %(HHĨ[]A\A]A^A_@AvLft[LLUHcDH1HE @ut*LLUHcI$LHcafDHcUfHc]J5fAWLcHAVIAUATIUH-X@SKHHHdH%(H$1Ll$E1HپLD$ ׮{t'Mm1L#0H5W<s I$LKt~HfHE @t[D$ tMu.H$dH3%(HĨ[]A\A]A^A_DAvLD$ D$ fDtkLLUHfHE @ut(LLUI$Lo_f.EI$LK;fDE+3AWLcHAVIAUATIUH-PW@SKHHHdH%(H$1Ll$pE1HپLD$ 7{t'M1Lk"H5rUJ;s I$LFtzK1HHE @tMD$ tMu0H$dH3 %(HĨ[]A\A]A^A_DAvLtft[LLUfDKHHU @ut'LLUI$L`DE]Ks2AWAVAUATUHSHWdH%(H$1t GH]HEH6 HH9uH $Ƅ$EHUAEHHL$IL58U@IfDEL LM-H5S<1m9E1H[HH{ uHLHASMLL^_tHcC(HHAD!uLH!%tDHQHDL@HL)2H!%tAM HDHrHD։@LHHsI)L8ZYH[HEEu1E1H$dH3 %(0H[]A\A]A^A_ÃE1ҾH7¸tH]럿<IH HS@LYHu(HL-tNHPI9E1LHپWHEH ucHEHǀ EL*H5lQI7EL*H5AQ7E /AUIATA8UHSHH?THtwH1ҾHH(HLhD`C ЈCu%H=H}HA.QHD[]A\A]fK1Lo*1ɺH5wPE1L6HD[]A\A]ff.ATUHSHH薽}LE*8HHHuOH}(SHHHA!HHrHD[]A\H¾HpAąuLJ*1H5}OU5HݼL)1E1H5DO!5D[]A\fL E1于H5O4HsD[]A\ff.AWAVAULcHATL%GP@MUHSK\HLHH$Lt$dH%(H$1[E1HپLD$ "Cs HLUuqH$DHBIHtZH1LLHx貳D$ t H$HH$dH3 %(LDHĨ[]A\A]A^A_ÐKDHIAD$ @HIt$IHH1HHGIG HHHxLLHf.pHCM1L*(H5AM3@E1ML$L4(1H5L2fLE1eML11H5L2*f.AUATUSHHHHHH9tVHAE1 HH%HHޅHEDHH9uHD[]A\A]fHA[D]A\A]ff.SHD^HcHtVH@BvDwjDIL-'H5KPHTjD1h@B 1Ƀ1XZH[@@BH[fDSHKHt HH@[ff.HG@9tHxH9HGHHuH@ ff.AUATE1USH_HD9tZHpHXIHGHHuH?(ICKHt>(Lh H@H@L`HH[]A\A]ÐH[]A\A]1L1ɺ[H5_O01ff.HG HGHuHHPHufHGHuHHPHuH f9s H@HufSQJHHtHH[@LX_ 1H5`_/fUSHHt1HHIHtLHXHH蝉H[]Ð1L1ɺ&H5^/H1[]fDLY1ɺ)H5^.1ff.fUSHHt1HHQIHtLHXHHMH[]Ð1L1ɺ&H5[^.H1[]fDL1ɺ)H5(^Q.1ff.fAUIATIUSHHH+H9u:HEHI9t'HHsL&uHHΈHEI9uH[]A\A]f.UHSHH?HH9u fDH興HHH9uH[]fDATUSHH9t8HIHH9t HsL|%u[]A\fD[1]A\ÐATUSHtCHIHHH¸t []A\HH[L]A\vfD1L71ɺAH5\,[1]A\AVAUATUSHtHIIIH9uT@HL9tHHSLLAŅuLĮ1ɺT1H56\Z,[]A\A]A^[]A\A]A^Ly1ɺP1H5[1 ,ff.AVIAUIATIHUS#I]I9u`HL9tPHsLHLLHnŅu1L1ɺsH5c[+[]A\A]A^@[]A\A]A^AUATUSHHH9tJHIIHH9t0HsLtMtHSIUH[]A\A]1H[]A\A]ATIUHS轆L賆9u/H]H9u[]A\@HH9tHsLu[1]A\fAWAVAUATIUHHS1H(HT$iLHD$<M<$D$M9tI?M?HM9uD$v HD$HHsHDHD$HtvHD$M<$M9tPH1fMoLHLIH%L9l$tLt$Ht$HLL%M?M9uHD$H([]A\A]A^A_ùLoYH5HYq)ff.@AWIHAVIAUIATUSH(Ht$L$4LIYHD$Hu_+f.L)LHpHCHHLH$Ht$LHSD$uFIA}LLJ, HuH\$HHHyfLLLHtfLX1H5X<(Ht$LBHD$HD$H([]A\A]A^A_fLY1ɺH5W'볹LWH5W'f.fDfDSHGH1HHH K0[fSH8HI1P-1LWH5W''XZ[AVAULo ATUSHo H]I9t2IIDH}1ALIāHHHM9u[]A\A]A^ATL%g UHSHfHE LHPH軁t[]A\fAWAVAUATUSH8HD$pHD$dH%(HD$(1DO0RHI)HAH I LcMHD$LD$u!HDHtD9-D8Lc(L$I,$HHD$I|$HLd$ HEHDfHL$E(HEE8EEHBHM@HL$U,1ELu0HM8fU(HD$ H{ LtHL$(dH3 %(H8[]A\A]A^A_LW11H5U$1LU1ɿH5sU$1DH;D$HL$Ht$HHH9H)Hc ~D1HHHtHH)LdI9HULd$ 1LlV1ɿATLL$ H5TJ$XZI9Hl$5DH[(HHH~1Pt$ LL$ H5T1L)U#Y1^QLKU1ɺPH5YT1Ut$0LL$0#H -HczDHLUH5TP1jUUt$@LL$@h#H01HLU11ATH5SUt$0LL$0,#H Ld$)fSHw H_G0tH{hH}C<[fH{x[6}fDUHSHHq8u9A0u3I4ulHk H}H{HHH|H[]@HsD 1L5U_1H5Se"EXZH[]HD s1L5UffDUSHHI4uDC0u.Hk H|H{HHHJ|H[]fDHCh<fDHsD 1LTH5DR!XZH[]ff.USHHHo(H}|t*HZH{ uAHH[]?1ɿLT_H5Q)!H{ PtH=QHH[]fAWMAVAUMATAUSHH(H|$AHD$HHDHcHH L4<1Ht$;HH9D$I)LH AE1Hu&=DHIL9HH*DKt=L)B<0HE]usDAtA tHL$LEULS*Q1H5qP1XZH|$H(1[]A\A]A^A_LL$1LZS1ɺH5)PH|$p1H([]A\A]A^A_AfDAE)ELS1ɺ31H5O(H\$H|$HH byHD$`HCH([]A\A]A^A_DULR&Q1LO1ɺH5SOH(1[]A\A]A^A_HyDH9-rDH;D$HL$H H9H)Hc 9D1HHHtHH)L|I9HzU1H5NSLL$LP1 Y^H9HKH1ɺt$D1L`QH5^NH|$ AY1AZ,f.LR1ɺ51H5NRPLN1SLL$H5MOH|$ 5_1AXQLN1ɺPH5M1USLL$(H HcDHL)O H5zMP1jUUSLL$8H0H|$1;HLvN11AWH5,MUSLL$(LH DnfAWE1@AVAUIATIUSHdH%(H$1HHHI|$ HZtpL{HLt(@fDxHw>AIl$(HI HvHHcvM9tIIwH{H;s u1AfDH$dH3%(u(H[]A\A]A^A_fDH=KL1kff.ATLg USHoHw8g0Lm@ vC8t[H}XL]A\cuc0H[]A\G0t AVAUATAUSHoHLoLusDL K1ɺn1H5^F11LK1ɺHC(H5.FH1uHH[]A\A]ALUF11ɺ}H5ELH12HH[]A\A]@S0HHt4HrH{ HHHCHHCH>HC%oH[AWAVAUAATIUHHSH(dH%(HD$1RH=wDAE[LnJ1ɺZHRHGDH HH!SIHE9DH(DAGIFMf MfHAVLIF8AF@HD$SnI~XJnI~hAnI~x8nI,n11cIHI.L|$IdžH|$Idž5zDH LIdžHIF HI2LE1WHL$dH3 %(LVH([]A\A]A^A_LH1ɺUH5C1E1봿ZLH1ɺPHżDHNf.HT$HHT$FLH1HT$HIF0AIV(IIfDIF0H@H4LL~H ILvlI9u^DHEDHHDHH9uIF HLE1LH1ɺ_Hl ff.HHGGATIUSHH HdH%(HD$1t$ Ht$ HHT$HV t'H<$t HD$dH3%(u?H []A\C9C@s1LHHtă1H ff.AWIAVAAUATMUSH8dH%(HD$(195ǺD]H1EAVH5KALGI$Y1^H\$(dH3%(H8[]A\A]A^A_Ðt$HHt$HHT$ HL$HV T$ Ll$ME]4EAE0AE0M} t'L5IELH@ HPAE0utIEh<LjD$ tAM0LAU8A}<1LD$ D$ DDD$ ELDH0IHgH1!AE0t"H-fIEHH@ HPAE0utIEh<I} i+Dy@AE4uC8AE4M,$LAE0t!DT$ ErmDL$ IEEt6AE0th<M} LiL$AE0\IELTD1ɺ 1H5> (SG4H}HWG4uj8C0u[DI(\(H{HGH+w<w@HAHHHHIHI9sH [HHHIH)f1LCH5=A C0prfAULoXATLghLUHLSHi@L0hu3H]hHgCuCuH{LgtHLgH[]A\A]fSG8HuqHYHH{(`H{0WHHC HH:H=3D.[H"D D1ɿ1L =H5< HnL81ɺH5j< Jff.ATUSH HdH%(HD$1t$ Ht$ HHT$HV .H$HtyC0t$L% DHCLH@ HPC0us4uqt;H(C0t!L%HCLH@ HPC0uC8u*HRHL$dH3 %(uIH []A\1@HsD 1ɺ/L`A11H5:; ZYfAUATUHSH8HdH%(HD$(1Ll$H\$t$Ld$ H~LHLHD$KHsLLHHH<$HD$$uHL$(dH3 %(u&H8[]A\A]HLH&$ff.ATIUSH HdH%(HD$1H\$ Hl$t$ HUHHHH$胊I$HH谉HD$dH3%(u H []A\Rfɸ5DDHD Dff.95Dt޲DH˲DDAUAATU1SHHcDHH~+H5D>tyHV1HHztc9uufLH=jDL|HtLHJ HH9uH2DL-/Dw1D.H[]A\A]øL.9H58f9=ޱD~HͱDHcfS19=D~xHDHc4[A1Lj>H58yAWIAVAAUATIUSHH(L/Lk1LH HHHHT$O1H HHH1IIJ;HHHL$Ht5HLLT$DH)LL9IGIAT$LT$tZMBI)ti1LDLHJILHAT$t-Mt@ID$H(MHD[L]1A\A]A^A_DH(1[]A\A]A^A_H([]A\A]A^A_@HDLLT$LT$LT$LD$AVAUATUSHdH%(HD$1H9tkIAHHIf.H<$HH9t>I<$MHDuHT$dH3%(uH[]A\A]A^fD@AWAVAAUIATUHSHHH?dH%(HD$1jH L9tyII3fH$HsLHHxLcH<$I9t>H;MHDuHL$dH3 %(uH[]A\A]A^A_Dff.AUMATI̹USHHH?dH%(HD$1Iyńt)HsH<$HtLgLL'LkH<$ZHL$dH3 %(u H[]A\A]8ATMUH͹SHH?dH%(HD$1IÄtH$L1HxHH<$HL$dH3 %(u H[]A\f.AWAVAAUIATIU1SHH(dH%(HD$1HGHt(I<${H HD$L9tuL|$.fDHD$HT$HHx7H|$-I9t@I<$MHDuHL$dH3 %(uH([]A\A]A^A_fDff.AUMATIUS1HdH%(HD$1HGHtH?I~ńtH$LHxLrH<$iHL$dH3 %(u H[]A\A]GAVIAUAATIUHS31H HHJl5HH1HHHH9s#HfHDLHH9u[]A\A]A^AWAAVIAUATMUSHHHH|$t$HT$dH%(HD$81LT$HDH HHD$ LH1HLILLgLT$1H HLH1HIDHHHD$(H9HD$0HD$NfHL$ Lt$0LL)IvH9HGLHE1HILL)MH;l$(t;LD$t$1HH|$uHT$8dH3%(uHH[]A\A]A^A_ø@AWAVAAUIATIUHSHm1H HHH1HJD-HHH9tIIŽE1fDHDLJADHL9uH[]A\A]A^A_f.fH8dH%(HD$(1HH<$HHD$HHD$LD$HT$(dH3%(uH8DH8dH%(HD$(1H1H<$HHD$HHD$HD$HT$(dH3%(uH8!HHDD$ dH%(HD$81H,H|$H|$HD$H6HD$ HD$ HD$(RHT$8dH3%(uHHAUATUSHHL#H9|IH-5IIU8sI1H55HIH I%A кP11HsH=>DXZTHLXI$M9uH[]A\A]AVIAUATIHUHSHK<4HIH2J<3LHA u1Et[]A\A]A^f.Eu u1A []A\A]A^ff.AWAVAUATUSHH $HH $HXdH%(H$H!1IH=jDHHtBL*.H=SDH.9t% %9L-!DLLLHH u~HLHulH 3HHLAǃ}EH [DHHLxAǃ}(H 3HHL[AǃAI|$1DD/DkHxHuH}HE1@E/EnHxHuA9 L$@LLH$@HHHHD$o$AA:$A4L{I} A:uHIuHD$ HD$H$HD$HM/HHt/LIHtHT$LADžHT$Ht$=D$8$%=1Ht/H{E1MAM~A/H9HLAAEfDH$H!dH3 %(DHX![]A\A]A^A_81M4PHW1H521PL1Y^A4@E1p -1HLHAǃW\f.8D81LPH0H50PLL$1UXZHD$I}LxGAVAULATUSHL9IL/DHsI|$2HE(HtiHL.SHL9tFI|$8HHu1L{1ɺH5/[1]A\A]A^[]A\A]A^fLz1ɺH5/a[1]A\A]A^fDAUATIUHSH{NHHtHH[]A\A]DH=)DIHt_H?RLHLaNtHLH[]A\A]@ILi2H5.{fDI1L1H5.Iff.UHSHH=kDFHHtN@@HHHCPHCXHǃeQH{ \QH{SQHk8HH[]DL11H5.f.G`uDSHHHxH;H[ff.@AVIAUAATUSHIHHID$H!HE@HHHEPHEXHDžmPH} dPH}[PAC`LHQPH[]A\A]A^DHHIHL*ID$HHC@HHHCPHCXHǃOH{ OH{OE@H=YD4HH`H=ADIHH=$DLLID$HHC@HHHCPHCXHǃOH{ OH{OfDL/1lH5+H1r|DLi/1|H5+TH=]DH1=fDL+1H5N+L.1hH5+L.1xH5*L*qH5*H1sLkuL*H5*@H=DtÐUL*HSH5X*H1HLO HMHHH[]MAU1IATIUH1SHx4HLH3~AmH[]A\A]H1[]A\A]ff.AVIAUAATIUHH56aSHHDHHH9H1HuTEt[tWML4-11H5*)Hu3[]A\A]A^fDHHŀ} 7H߽t8jMẮ1PHͩLPH5(1}XZ[]A\A]A^1E|8A<$MH HHDHLPH,H5K(P1R H @1EP8A<$MH <H~HDHLVPH/(H5'P1RH @HEZAVAUATUSHH $HAIIdH%(H$1H#EAHH'1HOx;1LLHH$dH3%(uKH[]A\A]A^H1AATL +H5&X1ZATUHSHHW8dH%(H$1IHHLH  L$ H!%tDHJHDщ@HL)HDtVwDHUJHHH$dH3<%(HĐ[]A\D|$D-ufH=LÀۅuH=DIt$ HHt&H=yDIt$$ HH[Lp1ɺ<1H5c%):@Lgp1ɺ-H59%1HH=DDff.fHH=DCff.fATIH=DUHSCHtH=DH"DI$I9u/HI9t H{H|uH[]A\,H@[]A\DDATHUHSHdH%(H$1HKËD$%=@uqHH=DHp IHHxHLH=DFH$dH3 %(HĠ[]A\IL$11mH5|#GD8Hg1PI1L#H5@#XZbL#1rH5#2f.HH=ʕDAff.fAVAUL-'ATUHSHL7dH%(H$1IIL9u DHIvLHU8HD$(uH9tzHHIH %IMA H5*"Q1PHH Av% 1RH=DIvH `ALEHIH9QH$dH3%(uHĠ[]A\A]A^UHSHH=D'HHtHH[]DHI@HH IL"%A H5?!1UXZHH[]ff.UHSHIHHt)H=D蕹HkHHtE HH[]L!1H5 fHGHth Zf.G@Ht'H?t!SHhDu H[H@[2@f+@ff.AVAAUIATIUS6I$I9u ;HI9t0HkLHuE[]A\A]A^@H=DLHHH=DtHH H= HHkL~Cu*I$HHpuHLBYfDHLeBEHH=DLHj>Å,L#1|H5H=ёDT>11LM#eH5[]A\A]A^LL1ɺjIH51DAL$`fDATUHH=[DSHڵH=+DHIH=MHIH@H I A@t~I95H@8L2#HHH % H5QP1UR5~H HLZÅ[]A\@LH ULz1RH5]_H=FDAXʹIH1H=2DLL"ÅHLÅ[Lh1ɺ1H5:DHe]UL!1RH5 YY^LH7ÅLg1ɺ1H5VL1!#1H5&H=DL}[]A\fDHXLg1ɺIHH5119@H1IĨLr ATH5URXH Lf1ɺ81H5a'M@H@8L HHH % H5QP1URH=DH wIHH=܍DL蚲ÅHLpÅLe1ɺ)1H5UU11LD R=H5b(XZ[]A\HIHYLMe1ɺCATAHUSHHdH%(H$1HH 1D$%=@tQ=`t*H$dH3 %(GHĠ[]A\fHt$(H3fHH޿xtD$%=HyDH9$u#ExHhDIٹL,H5 12@#8|I1ɺPHLP1H5X1ZfD84I1ɺuPHLgPIٹLdSBfAWAVAUATUSHH $H8dH%(H$(1H\$ IHHD$HD$ HH1u/1HHtH$(dH3 %(uDH8[]A\A]A^A_IL<1_H5ATUSHH $HH DHxUdH%(H$1H$IHIHHHxnLHH1HHtyH=RDHDH$dH3 %(HHĠ[]A\fIL^11H5HS@H=DH1?L_11H5~jfIL11۹H5|G3fL_1ɺ1H5Y f.LH5#H=DH1}AWAVAUATUSL$HH $L9uHXAdH%(H$H@1H8HD$Cat-H$H@dH3%(DHX@[]A\A]A^A_ÐHk8H$@II@HI IHL$ HAA1A H.H|$ HH8HD$@L%H$H$@ HD$HHLhLLtչH5LtH DH<$1MHARH4$H=^D1IHI~8H蒖ZIH8-AH{8H^VHH>-MtLH=ӄDL[HD$(H*IH=D:IH H=D]HH=mDHD$>IHHT$HXHZCaLLp4K`HaHYAHmE81LܑPHH5PLL$01XZ++ H|$MHUH1H|$L$@0L>1HL$E1fDH蘣HHAD貣HHu H$ dH3%(H []A\A]A^A_ËD$HcT$H=}DHHH H H%H ‰I HtPHp(fDHT$ Hf$I@H=!}DD詡HuL$t$|$ALɺLL$ tLL$LLHWbf.L11ۺH5 jD8ujH@1H5b 1PHr IPL$1 Y^ZD[8$IH DHHDH1۹PH LOPH51RH DAWLAVH5AUATUSHH|$dH%(H$1A{D&HD$D$L=v{DHo{DI9HD$0HD$(@MwHT$(L2HD$0H&{DD$zH|$HHHH5 HLHlHfDM?HyDI9-HD$@H$dH3%(H[]A\A]A^A_f.M1ɺ#LH5fMLN11H5L H51\HLMLQH5MfDc8H1ɺEPMLH5 1ZY@L1H5:6HHD$D$_@[yfAWAVAUAATUSHH=`wD'HHE1L5H=9wDH'HHH=wDH&H@HŅxDxDHAH-MAWI1H5XZEtH|ouLN1ɺ0H5\@E1HD[]A\A]A^A_ff.1DH=\vDATUSAąH=6vD%HHt[1]A\A]A^fDL) 1H5>LMJ1ɺ1H5룐LH5{fLI1ɺ1H5DL  H5f#H=iqDL_HqDHtL[L H5I1 LuAWAVAAUIATIUHSHH=pDdH%(H$1HH@`H!HH޿H!D$%=`RHt$(H;s8H{!Mt 1HLLA$VH$dH3 %(HHĨ[]A\A]A^A_fHH0uD$%=`ELH1ɺ1H5{fH=oDDLt$(HI$LHS8AH IHAUI ILz H5cQA1AVPHH % кP1H0H\MH\$(LIW8HHHUH IсIL AH5Q1SPHH % кP1}H0LHt$(H4H=mnDHHHI1LH5TDILd1ɺH5(11DIL1ɺH511DHXHS8HIPLH5HHH % 1P1R^H=omDH HL#L9u #M$$L9tI|$HJuLH1tHLbIH51K` DHphLIt$(H=lDPIHtQHT$(UL1H5HIH I%A к6P1AXLZHt$(HH=3lDHSHHIL1LfH5IL1ɺfL D1ɺ1H5|f.ILn1ɺLC1ɺFH5[8aBf15DATIUHSH]Ht'HѐH}HHEHEHtC`tH[]A\f.1HHLtS` tfHhLIH51K` H[]A\fUHSHH=jD7HtBHDH@HHt(HHH5tH[]DH1[]AWAVAUATUSHH $HdH%(H$1HHHT}1L@L$1LHAL褬@LILL蘸1H@2ILHPAH$dH3 %(D&HĨ[]A\A]A^A_fD+@1Ҿ1MLt1EH5茾@LL11AELL蝷蠵HMKE1LH5GP1XZH$1H@HpH HHH@2HpL!RH51E1qZ@1Ҿ|1ҾHwHH AąI61LJH5;@L1ɺ 1H5׼ݴff.fAUATAUSHHtGrŅHEt Du H߽r2H[]A\A]DKŅtHp7ŅH@2HKH??ŅuH7MH=L11H5读H?0f1L=1ɺcH5H[]A\A]f1L=1ɺhH5OH[]A\A]fE1HAADc>ŅtmH8AkHk>^fDHt 8L1ɺ}1H5DL1H5茺L11H5\HSH=dHtH=SHσ kL@2L1tH5عa1DfATIUHSHdH%(H$1FÅ4HL謲D$%=`tTM.LxH5Y11H$dH3 %(0HĠ[]A\fDHt$(LÅH=bDL HtHH.fDÅH3H;ÅHEÅH;fDL:1ɺ 1H5QfLY:1ɺ31H5)f.L):1ɺ1H5迷f.M)LgL1ɺH5qDL1H5v<L91 H5F Ht:LA91ɺ61H5׶ݮf.AUATIHUHSH裩HLHItFH= LÀۅu8-LHtHxLH1譧H[]A\A]H1ۉ[]A\A]fAUATUHSHHH9tCIA HH9t0H{ HtfD9cuLuHH[]A\A]fDH1H[]A\A]ÉAT1LcUHSHHHt Ht 1HfGt=HHtnHP@< u"J #H9rQH9tEH< tt6< t2J<#H9v)H)1< tHH9t D D uBD%[]A\ff.AWAVAUATUSHH $HHH$Lf8MHt$IHH\$0DD$IEHD$dH%(H$81HD$(HD$(HD$HMMAUI AIAHHA A1HYZYLct$Et]HL$LHHtfHD$t[BD5H$8dH3 %(HH[]A\A]A^A_1LHH(t }ufDH|$(u(HT$Ht$I<$譯uLt$(fD1yH|$LIH51/1@3AUATUSH%=~D-~D9AAH1ҾlHHLM1H\H=*nDşDD (@EADAALM1ɺ 1H5KfHt DH[]A\A]fDA1L1ɺ H51H[]A\A]DBH=_mD1蘦Ņ~DT-'@D%*}DjD1ҾHHD$LkHL$HIL31ɺ 1H5JD蛨1LJ1D 1H50@DLI31ɺ 1H5߰f.L3 H5`1豰@1ɿLD 1H5'u10@7L21ɺ 1H5Aff.@HZD@HtÐHH=谡tHtKHtFHF0Ht=xft2HH=UH€u1H1Dt#HtHF0Htf@t H@ 1ff.fAWAVAUATUSHH $HH $HHdH%(H$8 1u2H$8 dH3%(>HH []A\A]A^A_@HIHHD$(I@21ɺ-1ILUH5NHH5 H\$0ژIHL$0fDLH耐H|$0#tHH=HH=|H5H蕒H5 HH胒IHwHnH5H_H5HHD$ KH5HHD$78HD$HD$HuLHu$0LLW$0t<.31HD$ Ht?HǺL'$0t#<.tL?HL$HHA(DH|$t@H|$L$0t"<.tLHT$HB0H@H|$t@H|$L$0t"<.t 1LǑHL$AHt$H|$(Q@H5|GDH4L mGD11L:H5d輛IHH55GDH轓uL GD=GDHLDH>1UL1ɿH5VXZ/HߺH5EDL ED11LZDH5 L&1L71ɺH5|ϚDL16HT$HHB @Lr1ɺ)H5)聚@HD$Ht>HǺL$0<.t"t 1LߏHT$BL1ɺy1H5H|$uL(HT$fBf.=iEDL bEDH-DL1ɺTH5I衙|@1L1ɺ0H5$w1{ff.ATUSHH $HH5L%gH@2H$dH%(H$1谓HH4@HH`H$#tݹHLuHϑHHߺHH2CDH1ɺ]S1ILEH5!tHH艐ZYH$dH3%(H[]A\@H@t1Ls1ɺfH5 1LI1ɺY1H5ߗ#f.1LW1ɺOH5\诗1I賏HHH9uHH9tfxu1DHHH9tH;pu H9pt HH9u1ff.HHH9tBfHP0Ht(H LBH3L3FI uHJLBH3NL3FI t HH9u1@ATUHSHH9t"IfH{(Ht L诎t HH9u1H[]A\fAWfMAVIAUIATIUSHHHdH%(HD$x1Ht$4)D$P)D$`D$pHD$8D$4cH+ŅA$0u6HL$xdH3 %( HĈ[]A\A]A^A_fAoMAoU)L$P)T$`MLAfMt=LHHD$8HMLm11H5;AHLHHD$8HMLQ11H5HC8I$HHcJ %H9HcJ AH9t!Hc AH9tHcRAH9AfDfAAEDAHLBHD$8HtHL{ Ls M9t#fE;ou @fE9oM?M9u(H$H$HIrfDhHLHP HXJK`HLL{0HD$8{LIHD$PHH$HHD$gLHIW AwLHD$vHD$MtHI}3HI(H1ɺjAVI1LAUH5t$HH HD$HtaHxLp0HdHtѩHHHT$ AVHT$(1ILH51Rnt$t$ݒH HD$HtsHH HxHdDpHL$ Ht\HHHT$(LH1ɿt$(I1LAVH5HT$@Rrt$0t$(`H0HD$HtaHxLp(H dHtHHHT$ ٨AVHT$(1ILH51Rvt$(t$H HD$HttHxH9tkLp HHAMLDHtkHHHT$[H1ɿAVHT$(I1LMH5)R{t$wH HD$HH@H9HI$HT$@HjI$HT$HAHD$HpLAHD$HxHD$HH9D$@蛧HMw HD$芧HT$L1IRAVH5]1讐^_ML{HCE1IH$HD$LiH!AV1t$I1LH5GXZI} ,I}(#I}0AGI fAE藇HIE 軦H胇I]H<$IE(rIuHIE0҇I} I}(I}0I$LL1ɺH5,1}L1ɺ1H51MgHtI HH$KH$HfLxLQ11H5fHD$HbPfA;WtoHLIHD$Hp Ht#MLLL$赆LL$Ll$LL$LVHL4$LL$HD$@I υIHD$PT$ HDt$4HD$פHLT$(IH51RHL$(Q1AVH =fML11H5i輍A$L舀AMw HI/H1ɺAVI1LAUH5t$OH 8 IHLy1ɺ1H5)f.Ll$8HLL] HT$8ApDMw HtH1ɺIAVLHL11>H5$wfHD$HH9XHI-H@ Mw E1HD$DLLHT$8fDHD$HxL1ɺ1H5>LHL.tkHT$8AU1H=LL$LL$f.L)1ɺ1H5l}f.LA1ɺH59}@L1ɺ 1H5g}fL1ɺ1H5?}f.tLDH51}pL1ɺ1H5|Irt11HѺff.@%=uZHDtPGDStM?pGDku]G?[Ðu=,?L1ɺ 1H5{?fL1ɺ 1H5\{DsL1ɺ DH5.1{?2@L 1ɺ 1H5[N{ff.AWAVAUATUSHH $HfdH%(H$x1)D$)D$ D$0)D$@)D$PD$`<t,H$xdH3%(HĈ[]A\A]A^A_HHIH9uHH9tfxuo:LHH$)|$oz)|$ o~h)|$@o~x)|$PI9%L|$@D$ Lt$LH\$pMI1HfAoHID$HLfAoWLVM-oX o`0KS[$c4HHH@0LM(HyKLH5EHHDMLDH1AV+AWP1xyHE fAo.H D$ hfAovpHEHtH@0Htfxt4M$$L;$$D$ t Lt+L1DfAo>H@ xfAo~xL81ɺ6H5xxpfSHdH%(HD$1D$HT$HuHL1ɺ<H5 axD$HD$dH3%(H[HtlHuLi1ɺ@H5xL1ɺ-H5w@H8nL)1ɺB1H5Lw9oDAWAVAUIATIUSHHXL$$H|$0dH%(HD$H1H|$u)HD$HdH3%(RHX[]A\A]A^A_fDL1ɺ1H5HvLL9D$D$ Ld$MfMfA~wMtLL_AD$b SHH iLHHD$ M~0A$:M$MI$IJI3I3OH IBIJI3GI3OH k@Iv(I~HHt$(M蘌Ht$(HmIV(HԦI~HHDHT$(cH1ɿHT$0I1LH53RuI~XZ*HlHHD$(t(I~(OhHD$(D$IF(HD$M6I9dLLd$L9AM~M#fA~MtLLAGb LHH LHH IF0H8.D$ AJL*HMN01PL@pH51Pt^_H{0HtLxH|$HzI~ Ht gIF Ag`IG0D$IFA$@M6I9L|$0L;|$L-Lt$fDM?M9thIwHDHuIFM1ɺIH5%1vsIW1HHHPI7M?M9uHH9uMf.HH9t;A $u3HP Hc:.ZfxuHxuHx0tA$T$DL$ LM11H5hrmfDL=LLT$(LAWLT$01ILi1ARH5LT$8jrLT$8Li_AXIHI~05eHD$Mf0D$fMA?.L赈H1ɺAWI1H5LqI~0dHD$(IF0Y^D$A$H@L8CLI-H1ɺAWI1LH5SqM6AYAZI9s fDIIHNH3H3HH HVHNH3PH3HH L襇IV HIHHT$hHT$IV(HHLHT$hHT$HML1RH52Y1~pLgAXAYIH~I~(McM~(D$A$\@LHt$Ht$MN01LmVPDHD$$DL$ u.L,1ɺ1H5oHL1ɺ1H5Yo^LHALHD$;H1ɿHT$ I1L'H5 R?]oA_XmDL|$0D$ D$L;|$dJH0xMN0AWLr1RRH5nA$AZA[fL|$0L;|$fAWAVIAUIATUSHHHt$0L$L$,dH%(H$81H$HHD$LAIH=OIIHHƹH=AAED$H9tzfH{0tif{ubHCHt DHdEtPI~@‹Ht=LK0E11LH5LmMt AEDHH9uH|$D$(t.H$8dH3%( HH[]A\A]A^A_DIZL1ɺ11H5ƳL%'Em11HHtHLūIHAEbuILLLHtIH 3LLHtIH LLHtIH LLHnI~PHWLhHLCAoH|$H@AoIH(pLK0WH舂LL1ɺNAH51kL$D$8D$HD$@M9HD$|H\$XHD$ L|$f.L$|IH HLHt_IH HLHtBIH HLHt%IH HLH@H@M$$L;d$tEt$I\$uHLݽHt$ HX0D$8M$$L;d$uH\$XD$@1ɺLtH50PD$@PDL$X1{jL$A[]Dd$,ELd$D$HM9Lt$E1MD$=InHH|$IvD$(IHHt fx+M6M9tI~Ht %tM6AM9ut$(D$H"D$ELt$AąD$,L$A!Dd$ Ld$M9L-@M?M9IoHtI1HLHPI1HLHuH:HHD$HT$1MIIGH5̯RP1iZYHtHCM?e`M9h|$,D$`L11 H5dhLH$H;\$t@Ll$0Ld$HkHt"I~qHtHhHLHL9ù|$ IH5*H=bHH8aLi1ɺC1H5gf.D$@fDLX_LHD$ K_LHD$8>_(HD$@z`H|$ IH|$8H|$@HDT$,ETH{ L\$L} JZH{(AZLIHD$ L\$HC HD$8LHC(HD$@fA{LIC IkHkM`L]0QHsH^D$H$H5`tE^yH1ɺ\PLL R1H5.f_AXDL 51ɺ(1LH5VfH$L]IH;l$.LH\$PLLt$hMDt$HLd$`ID$IT$I3EI3UH H}H|$P|H}HD$H|HT$HM1LɼH5]RP1eXL߼Z1ɺH531eM1LH5 1`eL8HIHH;\$HLeHEIT$I3EI3UH AL|$PL{HM1PL1H5dL}A_XfDH|$ L\$PWH|$8WH|$@WL\$PLWL11H54dwD$ LN1ɺ 1H5 \dLؼ1ɺ 1H56d}H\$PLd$`Dt$HLt$hHD$H1ɺAWL1LH5cAXAYL\$k[fHufSHH@=?tH[fD[fDHLJHfHLJff.SHHHtXHǃ[DUHSHHt HH[]H HHtHHS8bHZHHHStOHHHH[]L1ɺ:1H5sobuf.H1yLZBIH551/b5f.Li1ɺ=1H5af.H@H+>HfDAUATUSHHLH@H>THHt[LM9t@HHI,xATsLAUI1H5UQaXZHH[]A\A]ÐHHHIwHH5ATILa1paY^HH[]A\A]AUATUSHDEtqLMteHH@H>TŅuWHLHI=wAUH5yATIL1b`Y^H[]A\A]HXHIvATLAUI1H5`XZH[]A\A]ATUSHHt9u'ǃH[]A\t$ t$ uHvH>HL$>vHLvATI1H5ea_XZff.fATUSu []A\fH8ŅtHǃ[]A\HHIuHL ATI1H5̷^XZ@USHH@/NuKC@HLuLIH5ո1u^C`u_H[]U8SHHtU1IH̄PL61H5u^XZjDHH[]2gfHtLIH501]1Hf?@SH@C`u11a!My {@Qx [[2ZfG@x-GD~GDtHHD3G@xeSGD~GDHuHH[ÐsL/IH541\H [Dff.AWAAVIAUATAUSHdH%(H$1訷pʼnLD$%$sE^@IExJD$AV`AFDEu |$} AFDL5(AF`Et@? >LDں1PAF@AF`E<AFD $|$D‰ƒEAF`@@AF`E$AF`H$dH3 %(Hĸ[]A\A]A^A_f.AFDDIV8H1ɿLbH57HIH I%A к9P1Z[]1ifDt/t+1MGL2H5״yZAFDLAFD6afH5P MH ٴHHDΨLϴHDH5HHEHH5UQRP1YAF`H ;Q8HE6AF`@+1LHL$rNHL$AF@Af`1MLwH5eYAF`@fAv@HT$KxIF8H9D$81MLDH5\YLL<1ɺ1H50XDL1ɺM1H5X]f AF`@EtqHML1P}H51`XAXAYAN` ML11TH5$X/HMPH5SL1W^_AN`LHD$1LHL$AF@Ml1LH5ֱxWA~@1QIFxbOf1ɺkff.1ɺ1Nff.11111ff.AUATUSH(dH%(HD$1HHG`t+HL$dH3 %(H([]A\A]f.II%ŅL$$H-Ll$膫H߅HLHDlHMULmH5UP1ATUH 9u{@HweEHt,L1ɺH5U1fL1ɺ1H5OUf.L8IHHkH1ɿUIL1AUH5WATTH H'L11ɺ1H5%TLff.fAVIAUIATUSHHDgTdH%(HD$1HH$D$1E~1H{DC1HT$hDCT$ы$KLCHAAUHL$dH3 %(H[]A\A]A^fŅtH߽hjAbGHGL1ɺL1H5SD$11TfDL1ɺ1H5OS$H&Ly1ɺH5jSKAWAVAUATUSHdH%(H$1HHIG`jiHDkTIۭL1ɺ]ŅuuD5?D9shEm1LrDAI$HM1L%xH I$HCpDshP@Ly1ɺ>H5o1R1H$dH3 %(HĨ[]A\A]A^A_fhHIŅuD5?D9shHLJIHD$0HM1LbQH I$HCpDshP1H5cQXZJH8FH1PL1MnH5v1Q_AXH(ŅHgLr1u@}I$?H1H5MH LI$HCpShxP1PYH^a(L1ɺ{1H5ƪcPQfDG8 EA}MH FH HDHL&PH_H5bP1RHPH L91ɺh1H5-Of.HspM1LB1H5OHCpI$A[[sHMsp1LEafDF8DHM1PLC1nH5+OAYHAZŅL^1ɺp1H5RNFf.ATUSHdH%(HD$1Ht_HIG`t3HL$dH3 %(H[]A\fGPH$t1@sŅ{@1Hc=H$HA$CPA,$dH1ɺUILH5J1MXHZ0L!1ɺH5M @ E8dBHIIdH1ATI1LH5ȧoM_AXD8BHHcH1ɺUILH5{1 MYH^ŅLU1ɺ1H5IL>DAWAVAUATUSHH HdH%(H$1Hw,1H$dH3 %(H[]A\A]A^A_ÐLIIHLL8$==HLHH=$=t =\L1Dt$D$yAE9D9H}bHILOPAVATTfDL1D|$D$yA9tKA9tFH&bHMLPuAWSH5˨1GKH fDMuf.Li1ɺgH5~K1Pf.I]8fL)1ɺ~H5>J1BDHdH%(HD$1HL$t)1|$N+HT$dH3%(u/HL1ɺ,H5AJ1HBAWAVAUATUSHH $HIHHIdH%(H$1M|}IID$8HD$MA}IHcKILH9fHc H9ILH$HI AUAHHA 16Y^gHT$ H޿BH5 HCIHH$L@HHD$t;HH|$LL1HHDHLPHH5P1RDT$(TD0HH ILަ11rH5~GE1'@IL1E1NH5CGHD$ILHcHDT$II AA 14DT$=IL=D1[H5֤TGSHT$LHhC4HD$IILhfDk>8;$IٿH T=HHDHLnPHH5;P1RFH @LP]t$}LUI1H5tFXZDILV1E1wH5ţCFaI>fATUSHH@dH%(HD$81H]EHD$H8?Ht$HHA\H|$w1茛1HL$8dH3 %(H@[]A\@1HFHEtHt$HHHƀH Ht$HD$HHpH HHt$}UHT$ Ht$HLd$D$D$ NLH |$ HuHLd$ HL"Hid ISM CH3T$(HIntel RaH3D$ H uHfg Sig. I9D$~Ht$HT$HH[HLPLL$(D1H5-DXZHfK`NH0HHxH53HHH=ޡfD1LH5COy1LH5ޠaCFfDHYLǢI1H5CHHD$HEK`5fDHYLIfHxYHLPLL$(hHHYHLPLL$(8L1ɺH5ΟQBL1ɺ@H5-BLq1ɺHH5 BHXHH5dPLL$( 1LAHD$(Y^H9ff.AVH HAUATIUHSH`dH%(HD$X1Ll$HD$M&t)1HH\$XdH3%(,H`[]A\A]A^HH\$W1L3IH:SPH5m1@A[[H\$H tLt$H HLMHcD$]HVWAVLٞ1IHbH5P1x@LL1H5d4AYAZDt$EMH ϽHLHD$HDd$VLj1ɿIHNATPH5`1?HcL$_AXA H5DHcH>HHTVH1IHؿH LCH5P1t?XZDHcH@HcH@HUHH5AVIL1?Y^7ATUSHPHcdH%(HD$H1HF8H%H9t'1HL$HdH3 %(HP[]A\fDIH H HM\ÃuH-UAT1ɺIHH5ۛPL1O>LZH=ƜYbH=LB?6AWAVAUATUSHdH%(H$1?/tOL1ɺH5m=H$dH3%(?H[]A\A]A^A_IH5RI18HIHDLH/Ht[$<#tIDLFI$M9uL9tUE1DHkAH`)H=DHOHL9uEL11H5ݚ#6H$dH3%(uH[]A\A]A^ .ff.AWAVAUATUSL$HH $L9uHhHt$HIdH%(H$XA1HHD$%iHD$7MMHAI IH$P1HAAHA 1j"L$PHL*oH/LƄP(HIHIH$PHL$1HYH!BHD$@H޿HHD$ -D$gD$X%=@`H'HHi@H0HL`H=LtѹLH=^)tL$P!1H@MHL'!HT$ L--HD$hIII IAAA HD$Dt$1AW0H @L1ɺ1H5W0D$f.'H|$D FH5͔ATI1AWL0Y^@L1H5/H|$l$HHL%L-8L$@H@IHMyLLtҹLLt?VMLHH11ɺHL/$ sH5H<HHD$HHx?IH>fDHLL$#LL$6H$0dH3%(LHĸ0[]A\A]A^A_f.ML^11NH5v!H؋H!ʁ t€DHHHD@H1H) HH9<3 u3_H؋H!ʁ t€DHHHD@HH)fIL118H5 E1@L)1ɺb1H5y LL$DE1L1ɺ01H59 E1aL7Lц1ɺ?IH51K E1-Nf.@AWAVAUATUSH8HT$dH%(HD$(1H7EH8HHt$HHT$AISWAP-SPAISWAPSPACADDD H9A_Lt$ HLHL9d$toM9.HS1SUSPENI9HS2SUSPENI9HULSUSPENI9HV H9D$t%EAw0HT$MfDfA~CEuH|$Ht H1HL$(dH3 %(H8[]A\A]A^A_fA~E2tHS1SUSPENI9IA~DtHS2SUSPENI9BA~DtHULSUSPENI9;A~D0apf1L1ɺ1H5݄+;,f.fUSHH $HH_8dH%(H$1HlQIHI IHAH$A1A HH xEHH޿t[H$dH3 %(HĨ[]H13L1ɺ)IH591"{18t/I1PHETLPH51XZ^@S1HdH%(H$1HHt_1f$Ut!H$dH3%(ujH[DHHs@uCEHH9uDL1ɺ]H51!1D1ff.@AWAVIιAUIATIUDSH(DL$ L|$hHT$dH%(HD$1HD$T$pDL$ tyD \$`u1LH=LeH1HH)|$0 uH8 tHcH 1*IA=vL HHtEHL}1ɿI1AH5FwAU4_AXEt$E1HL H!%tDHJHDщ@HL)H9r LLuA@IAA?uHD$HLLx M?A?Hl$(UfDAu]IoH H9rHLLAu A4MMUA?MwLMMu1MLzWH5s} H|$H<$RH$H$dH3<%(H$"HĘ[]A\A]A^A_DHc1|0BD$2fkHT2HDP 7H<$IcŃL(&11LyH5r H<$HG$H$fDHH9uB8PL1ɺYPHPLL$01H5vra XZMcH=>IcK@TH<$T$1LLxH5#r H|$\8L1ɺNPHPLL$0`1MLy_H5q H|$08OL1ɺaPHPLL$0Hl$(Lw1H5Uq@ H|$A8$H uHHDHPH"L}PH5p1RLL$@n H iLvH5p BH$HMcHl$(BL$87$H HHDHPHQLPH5Cp1RLL$@& H (HpFbHV8HcO HpHH9HcHsH9tyHcOHpH9tiHcOHpH9tYHcOHpH9tIHcOHpH9t9HcOHzpH9t)HcOHppH9tHcG H9HH]pHD1HcD$f.1 HcD(AWAVAUATUSHH $H_\dH%(H$1IHDŽ$t5AH$dH3 %(DHĸ[]A\A]A^A_ÐLg8HL$ ;LMMAHI I1AAA HRopHLxAąt!E\AAEJL$1ɺLLf$t\ 1LA_E\AEHE1UL6PٺIH5m1@H L)uٺIH5cm1LHLtٺIH5+m1Rf.ATUHSHv8HHH߁H}8HcS LcHH%H9tNHcH9tFHcS H9HHA~^HU8HH %H 1IHu>HWEH8YHE8HcSH%H9tWHotVZt`1[]A\fuHH,pHtfDHt[]A\f.HHtsL`H5lLHwHE8HcS H%H9tH5lLrHHtNH=an,f.L1ɺ~H5Ak11Ls1ɺH5 k 1Lr1H5jff.AVAUATUSHH $HH $H`dH%(H$X 1HHV8IHHH%D$HH % ЉD$ ~uHc|$At$H/u;HE8HH$X dH3%(aH` []A\A]A^fDDt$ Dl$Ld$P|6H)kLHE1EH$PLHm]HHƄP#HI6MLHHj1gH5,qLIHtLt$H¾@LHHL$ HT$L1H5~ ŃD$ HcT$HHH H H%H HL&89M1PHLPH5h1XZ\L$ ș<)HHcH H HH H DMLp1ɺH5;h11"DHL1p1ɺIDHH(Lap1ɺID+8{L11PHMP'H5g1_AXU@H1H5~gMAVLp211TY^rD8|$PMH HѹHDH1PH7LPH5g1R,H DML=h11%H5f1SHHV8HcO dH%(HD$1HH9t:HcHH9t/HcOH9t&HcOH9tHcOH9tHcOH9t HcGH9t1H|$dH3<%(u0H[HPtH$HcH%H9 ff.AWAVAUATUSHH $HxHIIIdH%(H$h1B2}HD$OIHt8uRLۀ1ɺhH5e11oH$hdH3%(Hx[]A\A]A^A_@HD$`IL$8HLHH$ÅH$H5lHIHHl$ LҾ@LT$HQLT$H1LH5=HLT$LT$L+8J1LPHH5xdPLL$1[XZ@L1ɺeDL1ɺk1H5,dfk8HT$LLHD$LL$HL$H<$HLLL$eLL$H<$H5kLL$ALL$HIA9t>CL1ɺPHwPLL$H5_c1M_AX1I1ɺtPH3L.PH1ɺULL$LkH5b11Y^LT$538Lѳ1ɺPH33H5bPLL$L}1ɺ|1H5b ATUHSHHdH%(HD$1HH$RtsHL$$H1ɺIHKPLc1H5bATSLd$ H LH tHT$dH3%(uUH[]A\@Mu 1HhAT1SILj1H5aXZATHIH5 cUH1SHt\ 1HHHA$.HE $1UFLj1H5)aXZ[]A\I1Lj1ɺIH5`[A$1]A\ff.fAWAVAAUI1ATUHSHxHt$8H$DD$DL$dH%(HD$h1蒽HAHD$`LHDHAHHeb5`?S$PDt$0L|$(ELH u*H\$hdH3%(DHx[]A\A]A^A_@H5v?ELSA LH$HaPH tH5%?ELSALH$HaE1P{H AZ@HD$,HH|$HD|SAąH|$HHH;HHHH?HEL|$81H5!@HHD$0LHD$8HD$@HD$HHD$PHD$XHD$`HHD$8At HH=`€fAt HH=_€AAtHƹH=_1HT$0H5_H'$LL$8HsAULg1H5]XZHAED+ 7AHH_HNEAH1PLJi1EH5P]@XZHv1LH5 _H<1HT$0H5^H$LL$8BHAULf fDHL$`HT$@HH5^to$LL$8OH|AULfLw1ɺ1H5d\Of.H>^HD$HH|$01 H|$HIdHT$P1H5!^HHT$X1HH5iHM1t$P1t$HLfH5[t$pt$pt$XLL$hH0D$ LH=1]HLOh11AUH5c[S_AXHT$`H|$L训H{|1E1LfH5[HLe1ɺwAUH5Z1A[A_D$t LH=^\!D$tLH=E\D$ $u&HL$0LL1H=e=LL$8Ht@~MVu1f.1HpH9t@1f.DAVE1AUIATL%%UnSHHHIcDLLH1A)HCH9u[D]A\A]A^@DED^E11E1IA uA }SIcEAXHEtR_IcAHDE1DI9t-HDEt A9}A ut'A uAI9u[@Ef1@AI9tHDEt A9JfD1@1DAWHcAAVAUATIUMt$ISH(HT$Hl$HdH%(H$1HM9iL$$H$E1EusAIvHnHEH=PQE9HH=4QHT$HE~@AMt6L;4$AVHLHE~9BI~A AHھEIٹHL^1AHT$AHDO=E~AMt6L;4$HDEH$dH3%(DH([]A\A]A^A_ÐAI~HIٹHL ^1HT$H=ADNE~@I~A AtHھAtAd5fHھIٹHL]1AHT$AHDOE~EAwHH8HEH HH HH9ufDA:fHھHھ +f.@t't5t>t@tB-t#1HHlDøڸӸf.tt-t6t8t:1t1HH;lHDøڸӸfATIH5[US€tmH-k1LHt`Hu H5[L€t)1MQLVfH5}[ 1[]A\fDHcHfkH[]A\f.HwHjHcH>DHHHH[HHHH=`HH=ZHָtqH=MHָtQH=Hָt1H= Hf.1ff.fHc>Hff.ATUSHGYuLgHHKPHGv ǂG1HBM1HHzHLx8HSPHGDGH[]A\fL`HwfHCPH1L*dLAT1H5YXZDATAUSGHv LJG1HBD HXHZpxGDGH[]A\@ELX11H5bXDHHHjDLH@HHHjDLH@HHHjDLIH@AWAVAUATUSHhdH%(HD$X1HHl$@HH _D|$HHHDDLL)T$ L$D$fHIqdHL bUT$IH5VRD$PLAVL$0Q1P1AUAWATJHPHD$XdH3%(u7Hh[]A\A]A^A_Lid1ɺH5lV f.ATUHS7HHH9L%qV@HPLwVH5UHBPHrH1L@1tHC 1LMVDH p$DΉH5U$1=HXZH9tgDKCH1H5UMDȃP1HC Y^HELU1ɺ1H5DUHH9u[L!]1ɺH5U1A\L7U1ɺ1H5Tf.AWAVAUATUSHXdH%(HD$H1HHII@LH\\\DH-xL UH5iTL5 UELULE11Ha1LUIH5&T1HLDcIuLKpH1H5S1AVLToHYHH_HH9ILI)HIHLLH(1PM1L^H5bSXZ+t LwT1ɺ51H5 SDA$bDLLNT1ɺ<IH5R1kD11@LLTH5RC11ALFTAH5RD11L7TBH5bR<$CL MELT11H57RL11DH5RHD$HdH3%(HX[]A\A]A^A_LII)IH@ILR11*H5QBMDAL S11>H5QHfL R3LELxR11H5CQfDL_1ɺH5Qff.@ATUSHPdH%(HD$H1H[HI@LHXŅH߽^1LRTIH5P1<$VL  MELBR11H5ZPH8RL <LDȺX11L[H5 PH1ɺZDLRH5OD+P1zXLZ1ɺ\H5O1WHL$HdH3 %(uXHP[]A\@L]1ɺR1H5ODLY]1ɺO1H5_OATHE11UASHH0dH%(HD$(1HGPHH8D[pLC`t 4$1҃HCXAE1E1H҃HsPHH6WAQASL@H5NRrUATARAPL,ZP1QsHQ1H`HD$(dH3%(uOH0[]A\1҃HCXL$‹|$DL$ AHDT$]HTff.fAWAVAUATUHHSHHdH%(H$1HD$@HD$HHD$PHD$X\D$L$H{ @LQUAŅ1HL$`AHAHHCXDD$`%E E1L5lOHHmOLDLP11H5M1ҾH豜AŅ HCP1H5LLXHsH1L@NY^HCP1ɺLOH5LL1 M1ɺL OH5nL1M1ɺLOH5JL1H}HgH}HIH1ɺATI1LNOH5KAZHA[RAąO11L4XH5KE1SHHLpH9 HD$HWLM1ɺIHH5JLHH1 IEXHt%LHHLM11H5LJIHt%LHHLM11H5JIEhHt%LHHLM11H5I}D$,D$ETHSXf HX H~1LfMH@H5ILHH1HSXD$$D$@LAW1ɺ1H5GIH$dH3%(DH[]A\A]A^A_1ҾH蹘L$@AHLLpI~ PAŅ/ 11LTH5HFE HAvHL /1LJH5H1 IFPAY1AZLJLH5JH1M1ɺLJH5+H1H}HHLJ1ɺIH5G1H}HsLJ1ɺIH5G1OL1ɺ@%UfDHPE1E1HCXH$H%HT$H1HD$$AD$ H6TLK1ɺIHH5 GLT$LHH1LT$1LJH5FIH@LHH1]Dl$HSXD$,D$IIDAH D$(EL$du  T$(HHuHQEL C1{`L-J1ɺIH5C1DKpAE L(J1ɺ1H5BhED$D9Kpt!L#J1ɺ1H5B0CXtODKtEx!LDJ1ɺ1H5pBDKxLJ11H5KBH1ɺD$xH5&BLIPDL$|1Y^L1ɺH5A1AfDHLKHC\ LD1ɺ1H5A9@IFPLM1HAvHL@DAL5CH)|$tL5MHuCLD DHIHEIFXHPHL NCEUHH5@11RLMEj^_QLC1ɺ1H5@?f.Ht$H}pAąt;|$<HPHEeE1HBNEtHBCXDKtEDKxLG11H5?L8G1ɺ1H5?_f.HxD$HSXH0rQH-@d ND$,D$D$$D$fHHLIEHCXD$,D$ID$$ID|$DD$AH L$(sDHfDERT$(HAL @oNH0Ht)H@1ɺLBH5s>LHH1D$,HSXD$D$$D$fH8K1LDDHLH5>1CZ@LK1ɺ1H5=xwt$,H1LCkIH5=1@MqD1ɺn1LCH5=f.t$HT1LOCdIH5B=1t$$H$L=C1ɺfIH5=1L1J1ɺ<1H5<wDL$h11L BGH5<QMH@LJ1ɺ}1H5<;fE1E)L{C1ɺ1H5G<jft$1ɺ HH59H@LHH1~HT$X1H?D$HSXD$,D$D$$D$HCPL ;HHH@fHt$PHHCXD$,D$ID$$ID$DEH L$(@H(FL=>1ɺ2HH@LHHRHD$XHp 1Li=#IH581bHD$XHp$1LQ=%IH581.HD$XH@x蝹1L8='IH5k81HD$XH@x蘸1L=)IH5681HD$XH@x1L=+IH581HD$XHH@HpHL<1ɺ-IH571RHD$XH8I1L;H57LHH1I1L;H5^7H@LHH1AL tG8ff.ATIUHSHvHHHڋ HRH>HtHBHH1H56MPL>1EHYH{^CUPML>1ɍTRPwfHBHxHE>HtCHL8>1MP1H596H_AXHDHxt2@UPML >1ɍTRP1H55XZ[]A\Ð[M]1L>1A\H55XAWL>1ɺAVH551AUATUHSLHLM9L==L5=HT5fDAU AE$MHL=ЃEZPME11RXLZK1ɺHIL=1IEH@ Hxpt;HEPLHHxEI1ɺHILP=1EIEH@ H@HtLMmM9:1Lv1ɺH5q4H[]A\A]A^A_ff.fff.AUATUSHHXdH%(HD$H1$IL<1ɺH53)1聿L11L<H53YLMA9HLDL{<11H53HC1ɺLh<H5f3H@LH81HdLW<1ɺAH5231DK(11LD<H53蛾C`%t!=fHH|+HIHдH HIHL@H52Q1L-L%4RP1&H HJHߨME<L ;L@MDH11ATH5C2ؽ_HAX D1ɺ1L;H5 2蜽H1L;AH511pHh1Lp;AH511DD11L\;H51D11LM;H5_1A1ɺ L?;1H5;1мH;HH1L$; IH511蔼H;1LC2IH501bD11LH2H50:+H;HH1ɺPL:1H5f0DD+XHZ>H;HcH1ɺPD1H50LW:覻Y^H{hH@H7LK:1ɺ"1H5/IdL11#H5/CHD$HdH3%(HX[]A\A]@=u:HyH%HILI=1ɺH5L/=H:HHRL ]1_11LY8H5/藺CaHVnL G8LDȺ11L78H5.`L WAWAVAUATUH-9SHHxDdH%(HD$h1CA)HC`%H=t'H-8H=tH=H-(H8HELd$ H{h@L5|$ DHH IE̋DDDDt$)DAt$D$DHL$LDT$ DL$JHA_HL$L;Qt$VL$H5-QT$(1RSATAVAUDT$DARDL$HAQLAWPP1s`UHpHD$hdH3%(u5Hx[]A\A]A^A_DL;1ɺ=H5-虸袰fATUSHH;HH;IċH)ƋHH;HŋHH1ɺ_ATLL ;H5z,UP1H []A\ff.fATUHopSH_pH9t4L%o@LK8M1ɺgH5!,1请HH9u[]A\fATUHSHH9t6L%gofDLK(M1ɺpH5+1WHH9u[]A\f.ATUH SH H9t6L%ofDLKM1ɺyH5i+1HH9u[]A\f.GH ;HcH>L51H5+锶@AL3:1H5*^fDL91H5*4@LY91H5|* @L91H5T*@A1L9H5)*鹵fAWAVIAUATUSHHt$HHT$PHL$XLD$`LL$ht=)D$p)$)$)$)$)$)$)$dH%(HD$81Ll$ E1҅AE111AEHD$,H$E}kH4>H8褱AǃwIcHDP@t HcÃD|,A=w3McHFLLH$0D$H;HD$HD$@D$0HD$ 艦H;A,E111'A tT$T$H8觫t$T$)@A HH>L$H8eL$H> L$H00L$AyH-6EAnH-63H} H}u q Hr>H=0H艬n 5 1EL01ɺH5%艱D茩 DF$G$FPGPf.7Ht$H|$}ff.fSHHǃt [L51GH55Ұ[ff.SH3t|Ct w|C[D1HH5^|C=¸tD|C[f.H5P5HSHHHtDHM&?L 1ɺiHC L>aH541LK(HCaH[L)21ɺc1H54迯f.SHH(菢H[醢fDAWL41ɺAV1AUIATE1USHH54HTHE1H-L54LHHHt HLtiHLtS HH=ht9IE1HH@PHx >LZHtDMtIGIMt.fDH[H[MH[]A\A]A^A_IL01ɺ"H53LH1[]A\A]A^A_ff.HHH:f.UHHSHĦHHt\H$?HHC YIHC(HtmL_1ɺQH`HCH521螭HH[]@L 31DH52lf.L21JH52<H1"UHSHDO EuBH]HHtfDHHPHHuH]HڟHH[]̟@L211H52贬fAVAUATUSHnH]HtHIIIfDMtH{(L藤uHCHtLLHLHH]Hu[]A\A]A^fDAWIAVIAUAATIUSHHL LHkH]Ht7MtH{(LuLLHLAŅt HH]HuLqLHD[]A\A]A^A_ff.@ATUSH_IHcHHHHHSLH/0HDHHHHkLk1HHbH5+1HCHSHCH+1HC(1C H[]A\fL-1ɺK1H501譪L011ۺNH50肪Lq01VH50\HDnf.DUSHHDO HoEu.H}HEHPHHH[]DLQ01H51ԩfATUSLfHt/HHH9t@HsI<$CHH9u[]A\fDI<$[]A\AWAVIAUATUHSHHLnHtH~(HpHpAąuYHL=uCڿI}H^L9 LtCL95AHHD[]A\A]A^A_@HS8HE1Lq/H50HIH I%A к\P1葨_AX@IuHHLHH[]A\A]A^A_IEHHLc`HAąCa LtCSdMDžuDHLsCL 0MHH5/PL01֧Y^H+H9uHmH9HuI}LuL.E1云H5/zDCduHL z/VDHALZ/IH5&/1K` H谽L-dIH5.1٦@HArL-jIH5.1蛦fDATIUSHCHH8HL`HXHt2oXHEHt0HHHHkL-HHH5-HCHHCHHC(1C ʥH[]A\fL (1ɺ>1H5-蟥L-1H5-{H}HtMH1SH[]A\L,11ۺH5;-2cDL,1H5 -fSDO H_EuH;[UDL,-1H5l.輤H;[#AWAVAUATUSHLvbdHf%fHH9E1AAfDHsI~Sx"IVD<AHE1H9uDEtlMd H諺L-IH5-1ԣH1[]A\A]A^A_AFƒtm <t9f.H[]A\A]A^A_@EuHH(1LH,1ɺH5-PAN1L+1ɺH5,#AFAFafAWAVA(AUAATUSHH=,H(蔻H HI[HH/L @DAEH=, D @u>IHHI;HHD$ 8/H@D$ Hut$ HLɼwL,HD$Ht$ H} JHEHL$ H0LcDHsar/L(+10H5`+諡LK1L+H53+胡LL#1ɺ1H5 +WL1轺H(H[]A\A]A^A_DD H薩L"+IH5s#1迒Kd1[]A\@HL0HHFAT.L"UI1H5#lXZHL$"$IH5"11K` DS0܊HHtTLHHHTLe"HCH)H5s"HC(1C 蹑H[@L "1CH5>"茑f.SDO HEuH[VfDL"1)H5"<H[#UHSHHHnǧHS8cdHl$tH[]@HI1RL!H5#"輐XZKdH[]f.U0HSHTHHt\HEL!HkH=HHCHH5!HC(1C -HH[]LY!13H5h!f.SDO HEuH{ƂH[齂DLY!1oH5>"褏fAUATUSHH(Hz8dH%(HD$1HFHD(D`D$ bdJt~1ARE!AHT$ H6ŅuJSdL$ ЀtЀ CdH誥L!_IH5o!1ӎ'Ht$H;t?H;D$HL$dH3 %(H([]A\A]fH(LL "IH5 1QKd1fDKAA,D fD#AA,@D f@AAD f.HxH(L~ IH{ H5- P1蕍XZ=虅fAU0AATIUSH-HHHC HH?HCHHC(HHD(1Ҿ#LQ1HkLIAH5f1UEɺÌHH[]A\A]DL1{H5&茌f.L1H5\H1BSDO HEuH[&fDL1?H5n H[~SHӃbdotaH ??H8?H9tH;Yu FH9YtBH H9uKdH^8H5IL1臋1[Ð[SHHt!HXHH=?[Lt$H5x1[fH=e?@S0較HHtTRHHHtL=HCH)H5HC(1C 虊H[@L1IH5lf.SDO HEuH[6}fDL1KH54H[}ATUSHH $H1dH%(H$1HHHHHH&5HHAąuGHHAH$dH3%(DH[]A\H6LuIH5P1E1.Md@Hȟ/LIfH訟L3=IH51шMd@?Ӏu#HDbdH8t"Hf.f.SHH$L&IH5l1MK` [ff.@U0HSHHHt\HELHkH_HHCH'H5HC(1C 轇HH[]L11UH5茇f.SDO HEuH[VzfDL1/H5K<H[#zJdJd@tauXBbuRH@uPtJdH蕝L(IH51辆1HJdS0\HHtTBHCHHLHCHH5UHC(1C 9H[@L19H5  f.AUATUSHH $HhfLdH%(H$X1H\$PIIHHHHH߾)D$0HD$@r]L{1ɺ;1H5tHuIL1ɺ<1H5II}HD$@H\$@D$ HD$(XHGZHt$P`HHTIHHL$HLHHL11LQH5GʄHD$RL LuH5HLE11薄Lr1LSISH51jH蒇H$XdH3%(Hh[]A\A]DHu1H5M71L Y^f1LLH5Y܃HEHH@PhgfLY1BH5蜃5{fAWAVAUATUHSHH4$H|$dH%(H$1HD$8ݝHHHy1Ht$8HH ț>xL|$8/E1H-THD$(L$HD$4HD$ HD$@HD$LMIfK>HLhLLH=wt|LuHvnI|H5euR_L-vHt@HT$ HxHD$1H5mII9NHC4Ld$IDI(ID$pAoUhAT$xAo]xA$I}蓉HL`H|$HLLIVH1ɺAWI1L-H5LkZHmYH;l$L}AoAoOLsXLC4KD8LHCp<LCxLC|H<$HHg IHLL:IH51E1j@D$MMM9uP@1ɺH51IL=Tj1H#%M6M9yI~HH̀HH#uIAL7H58i EH{ALIH51iID$0Ht$0HD$@HD$8H$Hx`HGP`HH{M1ɺ1LH5;iLLd$ADž,H$HH@`H@Ph1MLWH53h H}LfIfDL0@ADžLmADžtXALE1H5fhH{7LIL1ɺ1H5ohWIE1LH5Bg*L41ɺ1H5g_ATUSHH%IHI$H9t0HHPHJXtDHPHJXuvHH9uLtJH(1M$P1L#H5lgXZLEj[]A\fDH11LDM$t41ɿ1LH5fL;a멐L11ۺH5fhDL1ɺ1H51]fCAUATUSHH $HdH%(H$1HIHHAILHHH1#Sx7DLHHH$dH3%(u;H[]A\A]D1L5H5e1]ff.AWI1LAVAUIATUSHPHdH%(HD$@1B(H|$(IHt$8H5vHD$0P1eH{hHD$0D$HD$XHGZHP`HLp ILŅ I\$ I9twL=0fDHCH@0HtHLLЉŅ~HI9t>HCHLLP ŅuM1ɺ[H51cdHI9uID$LH@PhHL$8dH3 %(HH[]A\A]A^A_@M1ɺ`H5R1d`fDL11NH5$cL11SH5cID$LH@PhM[ATUSHH $H1dH%(H$1HHHpHxHHHILHLHHH1JPx>HHLH$dH3%(u\H[]A\L11ۺH5bL1ɺ1H51bZfDUSHHHHxt{H裷HEHHxGÅHEHHxt\ujY8HiÅH[]ÐPLH5JH11aH[]f1L1ɺH5zaH[]ÐLL:1H5EaL1ɺ1H5t1 apff.SHH?`Ht[fH[WATUSHH $HHdH%(H$1HHHx eHHLHHHHH1xM&PHH;HAHH=@(9C(iDO1HG'Hc1H-HMu)L1ɺH5_f.H$dH3%(H[]A\Du1Ln1ɺvH5N_HfHH1LsH5lHLH1_XZ`LI1ɺH5.^@DNL1ɺ1H5^fHuhH{hDsNHaVHHw :QHSLHkH51(^[AUIATIUHSHHHdH%(HD$1P1҅Ict$0H|$NHGHHfH HH9uD4It$2SI|$LHھPHtP~It$HRIt$ PHL$dH3 %(uH[]A\A]1H|$[UHH=)C0Mu(CHD3T8QVILB1H5$\H(C10}(CHH1f *CHAT1ILU SDHH5E<\I<$4>WHt)H1H<)KI,$#[]A\f1LH5`[[1]A\DUSHHGP;Ww(HS CHSCH[]ÐHwHŅt CL1ɺ1H5O[ff.fG00NG0G0G0PW0tfDH0ff.@g(fSHIкH sdH%(HD$1I)H{o$HAHHD$Mx CP;Sv1HsH{Åt>HT$dH3%(uuH [ÐCHUÅt7Ly1ɺ1H5ZDLQ1ɺ1H5kYyQff.fAUATUHSHH(H$L$L$t@)$)$)$)$)$)$)$)$dH%(HD$h1HfH*YK Kf/Hj=H 3fHHtHHYf/wLd$ @HLE1~FLl$fDLHLHH$PD$HD$HD$pD$ 0HD$S tH|$hdH3<%(u?H([]A\A]HfHH H*XH E9PfAUIATUSHHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1IH-x$LLHH$D$0HHD$HD$ HD$S tHT$dH3%(uH[]A\A]SOAUIATIUSHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1Hf$HLLH$D$0HHD$HD$ HD$S tHT$dH3%(uH[]A\A]sNAUATUSHHT$HuH[]A\A]f.IILHH5pLH2OH|$HQHtHuH{HHlQHuLD$HLLH1ÅrL1ɺ1H5!UQATIUSHHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HfH$1HLHD$HD$ H$D$0HD$S tHT$dH3%(u H[]A\LfDH1HH5 AVAUATUSHH $HHIIIdH%(H$1HAD3HH5L1ÅtrMDH 3ÅHH5L1\ÅH$dH3 %(H[]A\A]A^@L1ɺo1H5SDL1ɺnH51eSL1ɺr1H5?S]f.Ly1ɺs1H5S-KDUHAWI1AVIAULmATISHdH%(HE1lOLHE@HH5LH1H5L1ÅBH5L1ÅLjÅLBHHHH%H)HHH9tHH$H9uH|$LH'FH5LH1SÅ1LÅHCH5LPHAPL~LHH=L1XZIHt :7L?HUH5LH1ÅU'fDL1ɺX1H5QHMdH3 %(He[A\A]A^A_]L?1ɺWH5[1PL1ɺZ1H53PDL1ɺ]1H5 PcfL1ɺY1H5_P;f.H)HL:fH5L1ÅLn1ɺc1H5PLA1ɺd1H5[OfL1ɺ^1H53Of.L1ɺa1H5O[GDAWAVAUATUSHH8H|$HdH%(HD$(1mt)HT$(dH3%(H8[]A\A]A^A_@HD$L#L9E1fDI|$AM$$MlLl$L9uI}H|$5@IHD$ HLl$Ld$ 1HeELLL;L9fIO1HkLLȯM?L91Hv#LL蠯uL1ɺH5NLAL^11H5xML=1ɺ1H5WMfD1HDLLH|$LHC1H5ŅtALl@>L1ɺH5QM/@L0@L11H5Mf.7fDLI1ɺH5`L@LA1H58LL1ɺ1H5 LeDff.fAWAVAUATUSHH $H8LnXdH%(H$(1HHAHUHH5H1AąC0H} {0NC0L$ LC0 AąLH5H1-AąALHAąrHH Aą0HHHHtH5H1AąX}`t$+cH5HH1AąHEhHt HPH5H1^AąUpH5H1.AąL1ɺ1H5J$AL11H5lJH$(dH3 %(DH8[]A\A]A^A_L1ɺ1H5JDLa1ɺ1H5{IDH}P:II5)fDUtUxxFH5H1Aąu.L1ɺ1H5}I HHHD$<H5VH߉1AąHFAąqHC0LHD$L9l$xHD$ AHD$S1DH5HTtC0{0HNC0H5C0AU 1#AE$AHHHH1pHhAM(t&AHHH1zIEHL$H5HHP(1IHIEH@ H@HtHLЅC0PS0?1H5%H2MmEL9l$IEH|$EgLuPHPX,L1ɺWH5bGL1ɺ1H5E1>GfLy1ɺ1H5Gf.LI1ɺ1H5cFnf.H5H1/AąL1ɺ1H5F"fDL1ɺ1H5gFfL1ɺ1H5?Ff.Ly1ɺ1H5Ff.LI1ɺ\H5`Ez@ALH50H`AąUHH5H1 Aą2L1ɺ1H5qE@L1ɺYH5IE@L1ɺ1H5Ef.LY1ɺ^H5pD@HH5H1AąL1ɺ1H5(D3C0PS0&H5ۙH1AąAL1ɺ1H5?Df.Ly1ɺdH5D@LQ1ɺ_H5hC@L)1ɺ1H5CCNL1ɺ 1H5C(H|$:L1ɺgH5fCH|$L1ɺbH53CLw1ɺnH5CLS1ɺkH5jBL/1ɺ1H5IBT:ff.AWAVAUATUSHH $HH $H8dH%(H$( 1IH5HHC0HD$C0C0MIHL$L9PLd$ Im LH=H{L9IHHA1LH51H6C0{0LNC0H5H߉C01HfH~4H=HJLH5H5HH1+HKHu@I>wHu@I>HD$ơHT$IHt:Ht51H5Hc"1LH5{HGHH+3HH4<H1H9HH9H1H5%H9AHHHH1d,HHtHBC0PS01H5SH`MmL;l$C0PS0u H|$r1H5H!AfDC0MIHD$L9OC0@H|$XfM1LH5)?Lr11H5?E1H$( dH3 %(D~H8 []A\A]A^A_f1H5H/3H1HHHD$L1ɺED$L1ɺH51[>DL$LD$L1ɺ@DL$L|1ɺ!D$Le1ɺ"@D$LM1ɺ%L1(H5P=E1@D$L1ɺ-;fD$L1ɺ.fD$Lſ1ɺ8fD$L1ɺ;fD$L1ɺ=fD$Le1ɺ?fD$LE1ɺA{fD$L%1ɺI[D$L1ɺ3DD$L1ɺ4-D$L1ɺMD$Lɾ1ɺDx4AVAUATUSHH $HLv`dH%(H$1IIHH~hLGLH5L1kÅ!U(H5L1MÅHEHfHH8HL1H5jÅAZLLÅHLÅHHt :+HHH5VL1ÅpHHH5L1oÅL>1ɺ1H5X:#fL1ɺ1H53:H$dH3 %(H[]A\A]A^fDLǼ1ɺH51]:H~L1HnÅH5kL1Å;H5VL1lÅrEPcHEXHtHPH5L15ÅLH5 L1ÅxLٻ1ɺ1H5o9f.HEHH@HAHaII5LY1ɺ1H5s8;f.L)1ɺ1H5C8 f.L1ɺ1H58f.Lɺ1ɺ1H5_8f.L1ɺ1H5/8{f.H5*L1ÅLN1ɺ1H5h70L!1ɺ1H5;7fL1ɺ1H57f.LÅ}PfOH5LH1ÅeL1ɺ1H5'7sLk1ɺ1H57MLE1ɺ1H5_6'L1ɺ1H596.ff.AWIAVIH=AUATUSHHT$dH%(H$1OIHsZIFHIM1Ld$PHl$pL9Ll$L|$YfDI>L=SIH@HLI~LH: H $H;\$tuA LL{$H1"yLڷ1ɺ1H5p5L1ɺ1H51M5YL|$EF8EIH5L1ÅAF0LLA~0ANF0AF0ÅLÅ=LLÅ(LÅ>IIF0HHD$ 辏ÅL1H5 L[AF0AF0wAF0ML9 I|$~tIt$L5M$$L9uML9t,I|$FuIt$LuM$$L9uAF0PAV0u H|$ k1H5 LjL1ɺ6H53Lɵ1ɺ1H5_3nDIHT$LHAÅ L1ɺ1H53%@LY1ɺ1H5s2I>Ht RLII~Ht 譇IFH$dH3 %( H[]A\A]A^A_f.Lٴ1ɺ1H5o2{f.L1ɺH5A2@L1ɺ1H52fLY1ɺ1H5s1f.L)1ɺH5@1L@L1ɺH51$@Lٳ1ɺ1H5o1f.L1ɺH5A1@L@ÅIHHD$BÅX1H5LgAF0AF0AF0IHH9D$HD$@\$,Ld$HHD$L4$L|$8IHD$@IGLhImpI]pH9E1HE8uH@HxHY#MtLt$@HmH9uMUI~H|$@!HH Ht$HD$HH&1LhHMupL9ttLl$0MIH\$fIE0uJu 1HHLIEH@HHLHHH1>1MmM9uLl$0Ht$1H0&LȐH\$pI} (HzzH<$IIUHH<$1H5H $HH5A0y0HNA0A01WfIUXH<$A(HH5/bIU`H<$A(HH5C=IEhHt6HPHRHH<$H1H‰H5IHtH<$1HH5 H $A0PQ0H<$1H5m}H M?L9|$WL4$\$,L|$8AF0PAV0u H|$ y1H5L(AF0PAV0H5L1ÅAF8!}@L1ɺ1H5G-}fL1ɺ1H5-Uf.LY1ɺ!H5p,l@1ML9\$,L4$1ɺyLH5 ,HL1ɺ1H5x,L1ɺ1H5W,cfL1I\$,dH5L4$&,L@R1\$,L)H5tL4$+NL)1ɺ+H5@+<@L1I\$,XH5L4$+cfH|$ &\$,L4$1ɺ{LI?HT$LHǐ>ÅL}1ɺ1H5+LW1ɺ2H5n*jIHH9T$L1ɺ_1I\$,L4$H5#*yL1ɺ1H5~*\$,L4$1ɺLL1ɺh1I\$,L4$H52*\$,L4$1ɺ|Lg`L[1ɺH5r)v\$,L4$1ɺL(!H<$1H51c\$,L4$1ɺLL1ɺH5)\$,L4$1ɺLH|$ 1AF0\$,L4$1ɺL}v\$,L4$1ɺLb[\$,L4$1ɺLG@AF0 HHH5麱f.AWAVAUATIUHSHHhdH%(HD$X1HH5MH1AƅYC0C0At$LE1L-DI$H @L4LhI|$HBG7HHHXI$HJT2HHHJXHHHHRHHD9LSH5sMD1AƅLĩ1ɺ1H5Z'5DC0At$LC0HBHxHHt$@Ht$;H{Ht$5}HHiAD$LLWRHߍpI$D9H5JD0MDŋH1"AƅzAt$LAD9UC0PS0u H{0/H58H1Aƅ\A;I|$@ELPU1H5E1"&XZH\$XdH3%(DTHh[]A\A]A^A_f.AL611zH5P%f.L0QJHD9HPHH5yMD1AƅLէ1ɺ1H5k%FfDL1ɺH5A%L1ɺ1H5E1%LY1ɺ|1H5s$f.H PPHPHHD9H5ID1*AƅL1ɺ1H5$ifLL$L1H5W$I|$>ELPULv1ɺ1H5 $LP1ɺ1H5j#1E1LkH5>#UfHSHHXdH%(HD$H1He)D$HD$ HHD$(YB)D$0)$HT$D$8uJHHHuHL$HdH3 %(uHX[]ÐH|$&AUfIATIUHSHHXdH%(HD$H1G4)D$)$@H)D$0HD$ HHD$(Bt$u t$RHD$HtHHHLtfD$HT$I$HtT$HL$HdH3 %(uIHX[]A\A]ùL,8H5"1f.H|$1ff.fU1H59HSHdH%(HD$1HH$Ht5H<$蜬HHtTH<${HL$dH3 %(HuqH[]ÐLL1۹UH5E!LL1ZH5!H<$|fAWAVMAUATUSHH|$H4$w^taL1H5 L1ɺH51E1 HD[]A\A]A^A_HQ=ILd$1HLL襁 HHLtXHI!9kuMH HtEu H8LLbADž&H HLL1@ADž1HHSHuHLL1ADžAML1ɺ1H5wfH=@ILd$H1LLH=蝀Ly1ɺLf1ɺ1H5vL@1ɺ1H5PL1ɺ1H5*ff.AWAVAUAATUSHH(H|$t$ ?t_%L1H5XD1L1ɺH57#1H([]A\A]A^A_L5=HD$fD|$ IFHtBM1El$tL{HLEHH@M$ID$Huʃ|$ L{H=LHL$H[H_1LWH57#H(1[]A\A]A^A_fL{ H=<LuAHtZA I$H T$|$ mH5%LPQHA7L{1MLH5k1CHD$HT$H H([]A\A]A^A_L5,=,L5= ff.AWAVAUIHATUSH(Ht$+HHD$HHzHh=SHD$HH+HE1RHtL`E1AFIH@LH516HAYAZL9"It$hJ<6H9`ID$pHHLH1LHIHt#LH)J<6H9RHHL)HHH脓H1ɺbPL1LH5.kH AT$|AD$xHHHDH;LIT$HtJH[]A\A]A^@HؒAUL*UI51H5X1Z[]A\A]A^ÐHC`1Ҿ,Hx,,HcHIL11*H56y@HHAH1ɺsPL1H5L4ID$hY^HIL$`IT$pHt H4H9I9L)H9HHIDHrfAD$xvqfH舑HLI1H5>[1]A\A]A^fDLHAH1PL1LfH54_AX@HyLIsHؐBLǻIKH谐HIHC`HxI+HŋHHHtHC`Hx+ATLIUHDSHHPHtH{h1H[(UH8SH(HHt1oEoMHoU P HE0HC0HH[]DL61H5y f.AWAVIAUMATIUSHHH>L:9$H AWI1H5 Lѻ\ I4$I>HA_X襸L{ϦLD$1;9D$H{(HC(t@HH8uH5A%r0N*>I3WH LVM2 x[H3CH M<${uoL9{u)AE!AmH[]A\A]A^A_I>H#AWLK1P1LH5-p AEZY fDI>#AWDKPH51ɺL10 ^AM@M<$_L9{RvfDI$I>HT$"HT$D 1LƺH5RP1 AZAMA[fDI>h"H1ɺAWI1LH5K AM {AXM<$AYfI>I$"HLSI1H58 []1AMH[]A\A]A^A_fo(ATIUHHrSHz(HBBHjtHB(DHH8uϦ8HLLHٺH苽Lt_[]A\D;!L?IH5#1d [1]A\ff.fUfSH8dH%(HD$(1)$)D$D$ wAooWAHHh 1) $)T$蹺HL$(dH3 %(uIH8[]fHG`H@Hh8 ALUH5aP1 X1Zff.H2fAVAUATUSHH $HH $H HjH]dH%(H$ 1IH߾/HH)H=L$HPHLI$Ll$HL$ LLLG)BÅ|$ H5IH;H 01AUM$L H59Hu_LAXLÅU|$ t8HÉxHuLDMÅHu MLCH51HuLY^+LY1%H5qH$ dH3 %(H []A\A]A^Lٷ11ۺH5bL1ɺA1H5?1A.L$fD$@1ML3H5Lt88|$MH $HfHDHL>PHϾH5FP1R5H @H-H8I|$HMHEHPH¯LPH5ڮ1R*H |$ A<$|$MLHDH,PHPS@LML-L%aLL9A9H5EIEHPH/P1R:tH Lx!;LML<A9MDHPHePATH5٭11H [c8FML٭P1H5uXZDAWfIAVAUATUHSHHHzpdH%(H$1HBh)D$@)D$PD$`)D$p)$Ƅ$HD$eHLKpHtoxh)|$poxx)$o oSHD$pH|$pLd$@HK@HD)L$@HL)T$XIw0LjjPH HHXHLHHHD$(-H{ o+osA),$A)t$L|$E1H\$ LH|$D H蒳IHtyLxMoIGI?H I HD$AUL t$I1H5ɫ XLZµIOIWE1I7AHAH\$ HL|$H2AŅHHLAŅaHT$0H5UHH\$8L|$0sAŅhHHAUDAHDExHDH{@Ht$(AŅtA}@o[ oc0A)$A)d$wfDAvDLKpAo)\$pAoa)$L 1ɺ1H5\H$dH3 %(DHĨ[]A\A]A^A_L1ɺ}1H5 E1Lf.L1ɺ1H5ܩ{f.LY1ɺ1H5Kf.1ɺALH5vfL1ɺ1H5LDAWfAVAUIATIULSHLvh$DL$dH%(H$1)D$0)D$@D$PyiA} D$AoM AoU0)L$0)T$@Ht$0ٺ LIMH Ht$ MH I HD$II H HD$IHD$(̯HtL=u<$H &H|$t L+|$H aM9L&HALPP H5٧1YE1^H$dH3%(DtHĘ[]A\A]A^A_f $MA ȅH m"M9[$I9s $LL)MI)M9LML)LH $LHLY AWHL$IH51Q1U;H AHD$ogD$H9HAI}@LLFD$L[D$?IE`HD$L`hIEhHxD$HIIEh8D$HxD$HIT$IGfLAG t$IWIU@LpHHhH@H@0@ D$蒴I}hALAomAouHT$` Ƅ$)l$`)t$pkD$fAo]Aoe)\$0)d$@Il$8L~AٹLݭUPfAH HIH;H HDLEHt$  L艬Ht H@HH|$MH HL$ ApeIHL$ H9rHct$L1HHH)HLELT$I4.MH1H|$(IH HHtHI>L9I4.I94$LL)H|$H?H9cH)1I4.HHHt HH)I4.L9$H H|$IIID$EL$|HALPH51AXAYD$@H|$HtL1HHtHI9{I)M9MCHChfHt$ 1ɺ L謪HH@HL@L@H (MHD$HIH -L9vK$LL)LfM *I)KL9SHq1LHt$H#$I4.}@LxH yMIz@Lx{ATLAVI H5'1m_E1AXMfH 3AfDbHIL} PH5Ρ1AYAZH L1H5L%{1ɺ 1H5xE1LH5ILyLf.AWAVIAUIATUSHHHHnhdH%(HD$81~ D$0oF oN0)D$)L$ ILd$HAdž L"HtSHPHtJHrHHt$蓪LAstoLD$ELLI tJHtH)H\$8dH3%(HH[]A\A]A^A_fL(yL IH51!1Doo^)T$)\$ LzLH HHtH@Ht H@H HI):fDAWAVAUATIUHSHH8LnhdH%(HD$(1~ D$ ZoF oN0)$)L$M9l$tH1I LLqIHtI|$ LUHt_Hs@HSH15wIH9HH莴ŅLLIŅ@L LӥE1HtH@HtLhI It$H蝋HHuqA$tvHHILDHL$(dH3 %(H8[]A\A]A^A_oo^)$)\$uA$tH+1L)HH9xH1vLIH5>1:f.ID$LHxHI|$A LH螩fLyv1ɺ1H5̜f.LIv1ɺ1H5f.I<$WHHuHLLUI1H5M1XZGLu1ɺ1H5#f!lff.vSHH@HtHH{[ ff.HSH@Hx0t [L'u11ɺbH5z[fUSH>tH[]HFPHHHph=nŅuHCPHL+H5 LsH1AXZff.ftMATUSHHv@Ht2HH1uIHH,vgL?t[]A\Ðf.H{@gLХ1ɺIH5R1Ef.H{@'L`1ɺIH51SE`HsL܌IH5Й114f.AWAVAUATUHSH&HHbHxDeHHCHA H{HIHGLuHi>L{ID$MM.H5LHHHtLXIDH92L HHaLLf HEHIvHLD HEH;IvHL" HEHIl$E111AD$ LHHC@ (tLmHmCHC@HyAucHH[]A\A]A^A_ÐLhLHp HHHD$MH MH1NLL$LM)HLfHlHHvLBq1ɺsH5RDLUH5fH{1Lp11 H5?DLp1ɺ 1H5WfLp1ɺ]1H5/|f.H5*@ML٢iH58fD1fLp1ɺ.1H5lf.HoM1ULH51yXZfLo1ɺ1H5 QHL1L1FH5ݕ FML11)H5f.L)o1ɺ?H5ykLo1ɺ;H5UGLn1ɺ61H54w!fHGH@HHtHf.SHGHXHHtcH;"HHC[ÐGDGƒE‰GAUIATIUSHHjdH%(HD$1HGD$H@Hx:H1HULD$HHHHC(LHC0C8!H{(FHuH}HHC@HCHCPŅHL$dH3 %(H[]A\A]H}LP1ɺIH51FfDL11H5WuDIEHH@HxL1H5X3^ff.UH@SHHZdH%(H$1HHHHHCHD$ 躜H}(HsH;Ht'H$dH3 %(u7H[]Lk1ɺPH5L1fDAVAAUMATIUHSHGHxHHtFHUMDHHtH[]A\A]A^fID$H1HxLA1H5AMff.fAWAVAUIATUSH8HiHH4$dH%(HD$(1HD$$H9t.IHPIEHuH;r@uCHPH9r@t6HH9uH|$(dH3<%(H8[]A\A]A^A_@AU AMDLD$$HI?HHHC(HHD$H{(HE(Ht$HM U0Et HK@HCHSP"HK(HC0S8HC@HCHCPLVH|$zLBHLEH}HHDLD$HT$H}(HT$LH hAt$(L^IEERLD$MDӺYAPLߜP1VH5Q ARM$LT$@H0H5H}(L:HK@HS0LԜLDHC(sHH5eQ RbP1ASLT$8ARM$H0L<H|$`HuH}H@ŅEH$@LDH{0;HC(HC0C8HC@HCHCPL3h1ɺ1H51qIHH@HxOLP1iH5H5HLHJI9t'L@LM9P@u&fDL@M9P@tHL9uHGHHA(HHE1HH?ff.@HHwHHHE1HHHwHHHAHAWAVIAUATIUSHHxHjLoHdH%(H$h1D$THEH}HD$XHD$HH$HH9t'HPH}H;z@uMDHPH9z@t>HH9uH$hdH3 %( Hx[]A\A]A^A_AT$ AL$DLD$THI~OIHIEHvHD$XAEEu D$PAED$8HID$ LLHL$H5-HTRPC(Q t$ P1TID$ H0H-HH-I9I|$( AID$(It$0M|$ HHD$H Ht$(HL$HD$ AHD$(HD$D$?O.C(LM9|HLm MzLLu( H5Dt$(t$8t$(t$8P1tC(H(LjL AVH5AWAUP19H0S(LH|$ L;l$mM9dLl$Lߚ KD.H5PDx1AVAAURkH E LL7D)H5PRN<2KD=T$PH)кPC(P1sD$pH DT$L9}H}Ht$It$ 蚒C(j AWLH5މAULP1H H}LHL$XLݓaH}謓D$8E0M|$ D$?AHD$ HD$(HD$HD$M9MBL;|$HL t$0ID$ H-PAVt$ RNH51VH0H1"C0HLt$`HLBK0YLHML<LHL$PHT$XHIH<H|$XH.D$PI}Eu AEjIHH{HHsH;LLHCH(gH{HHt$XDϦ D$8AEfDPC(LAVLH5t$P12H HL9HHD$?HL$HD$ L+|$K(LI/HIŁtH)HL,RxLAUH5eP1Q M|$ H IL9C(HLL~h AUPH51AKM|$ H mLLLT$HHL)L)HLHt$HH5HL$8Q RAVAUP1C(H(Lm Lu( Lt$(LH5ht$8t$(t$8P1C(H(Lt$8L AVH5(t$XAUP1bH0S(L|$?LT$HH|$ HD$Ht$H9D$@H9I9zHD$Ht$0M)HMLHIHHD$(HDPHL$ ADT$PKD=VH5gQ P1AWAURtH@DT$E LD)LAHD$0H5 D\$(MHD$ LT$ LASPL)L\$ PC(P1)L\$0D$pH LT$ MI9L9L9rrHLPC(LARAWt$ PaHL1LL1}H5A-|$?M9L;|$L;l$CL)D$?HHD$ HHL$$D$PM1E1HD$0HD$LP]1ɺ1H5L*]1ɺa1H5}iHLehPQ 6D$PLT$0I9H}Ht$LT$It$ 辋LT$C(LW LH5ARLT$AWAUP1/H H}LHL$XLLT$vM HC( LARL|$(H5LLT$AWP1H H}LHL$XLT$L+t$0LL{L $LH5*mPD$0LLH5PC(ARAWt$ P1+$H0LT$0I9 LLZ{1H5HLPC(LARH5eAWt$ P1$H0nL $1L5H5)lrfAWAVIAUMATEUHSH8HH4$T$pLD$HHL$1dH%(HD$(1D$HHLx(HP(Et%H@HHtHK@H9tL{@LEHfDHC0E1LEHH AHK L 1I9v <))<HL$ HEQHL$ QAOQHH5=V1QLWLPD$HT$H H@H}HHtqM LPH51t$AwAQLMH Eu}HT$(dH3%(H?H8[]A\A]A^A_AEwM LPH5^1t$AwAQLMH HK` vL1H PLL$1L݀H5~@ZY4fH}HH5~PLL$1Lw^_fM1ɺPLiH5~1t$AwAQLMH f.HHHHHP@ LMAPHff.AWAVAUATIHULLE1SHLIHC LkLP^_IHu HtMtHL[]A\A]A^A_Im1E1HHVC HAIuAH1AUILϐ1H5Y}XHZ=1LܐIH5(}1iMt,s<LKE111HL3DHL~1ɺIH5|1 f.AWAVAUATUSHLl$PHHIHMMMtHB H-HH-H IEHE(HH}0U8HF0L$ V8Hu L8AT$TI|$X)I9GoLL$ IFHu(1I<$DE0AT@HƃWHI65M=A)LSLH ÅI<$5ÅI>M<$Le0H](I^H LAWI*ATH5f{1SH Mt1HE HM0H-HH-HH)H H9HBIEH[]A\A]A^A_I>Hm(InH1ɺUIL1H5zXZI>I^H H5zSIL11AL$dY^eI>xL1ɺIH5cz1L)11ۺH5/zrDI>Hm(InH1ɺ"IUL ff.fAUATUHpSH(dH%(HD$1uHHHhH^H>HCHgHC8HZHC@H~gHCHCXͩ(HoH I>L-H>HChHLc LhL*LL*H7WHC0HbHhHSHHH=-{wHCPHZHCHHH$HD$HD$HUH{PH}LK81ɺU LzH5x1HL$dH3 %(H1H([]A\A]f.LE H5FxH{0HP(H1L1$ H5 xLkLy3 H5wH13LT@ H5w]L)Q1ɺK H5yw8@LQ1ɺQ H5Qwff.@UH1SHHrR dH%(HD$1H`LD$D$H^Hte@8HHHH@(H@0H@@H@H@PÅt[HL$dH3 %(uxH[]DH1vLbi IH5^v1DH@L\x IH5(v1ivof.DHG?HBHB˚BHfDAWMAVAAUEATIUHSH5BH|$u11eHHHHpH LID$X;H5P1AUATHEMjD$pLDHHPH$@TPt$xD$xPElH0AŅ6D$`HBH-ܙBHHtzHEHT$hHH|$PAŅtAHiHD[]A\A]A^A_HpAŅuLb1ɺG1H5ҊfDHHEHlE1f.LM1ɺ[1H5_af.HA LNIH5G1fDHH1ɺBATI1L_H5ZYLM1ɺ61H5ىE1AWIAVIAUATMUHSHHDL$ Ht H:Bu H$H1ҿHH$HobHHE1HtHEL$x9MLH L ID$pH5PD$hP1t$h$HH߃|$jAU$҃VL$PL$D$H$biH0E-HBL%BHHIwI$HLH~PIHHxI$HH$H$PD$XD$hI]8AE4HtHUHt HBD$xMtAHL[]A\A]A^A_@II$HYMAf.L$Xt$hE11H9PAM_HImL҈1ɺH5W2;MtAL LIH5!1HE1eDLL!1ɺIH51fHIHEH'L{1H5nfLI1ɺ1H5i?Ef.LyI1ɺ1H59E1 AHE1E1Q1R1jjjjjj;HHfDAUIATIUHSHSBuZHSBHLBHtcLtNHHuLHLPHHtsHHHOu,HLHH[]A\A]ÐHHHu1AL11H56 f.1LGH1ɺH5 HH[]A\A]ÐSHH^BuH|$`H|$HTBHw`H1H@H[AUIATIUHSHH5ZH(H;dH%(HD$1HT$D$ QtNHt$LyH;HT$ H5hI$PD$ HEHD$dH3%(uH([]A\A]fDH5XHt$DAVAAUATIUHSHdH%(HD$1HIH5?%LQH $DHÅtHLH51LQHL$dH3 %(H[]A\A]A^fDL[1H5.fL1H5H $DH,Å\L1H58褻@AWAVAUATULSHHH|$H$Ht$LL$HT$HHT$0L$HL$ L$L$dH%(HD$81LD$(PuJ$LD$(AHL$8dH3 %(DHH[]A\A]A^A_f.HD$0H@HD$0HuHD$0H@HD$0HtAWMMAVSPHL$@HT$8Ht$0H|$(H u1ɺD$LDH5mXDL$NfDMLH5=#E1&fDAW1LAVAUATULSHH(dH %(HL$1HD$`HD$HD$L0LhLAHH57LIPtHT$H5L:NADž'H5PLOhLl$MtuHAIH$Ht$L`>-{H@Hb1HHHIT$HxHBh%HpL9HD$Hu_rf.HpHt@HK1HH>HteHLHktSHD$H@HD$H8tHAVLL4P1H5`FXZE1MHL$dH3 %(DFH([]A\A]A^A_f.HT$H5LHHHAVLPLL$(HD$HLsLHAVHAVLLPjHrAVLLZP{ HKAVLLPo޵ff.AUATUSHt?IIH@uAHsLLLH?ŅtYH[HuH[]A\A]fD1L1H5L~2H[]A\A]D1Lg?1ɺH5~H[]A\A]fAWAVIHAUMATIUSHHH$H$HD$dH%(HD$81HD$(HHLHXADžHuLHCHH<H L}wIH5Q}15HmH(Ht$0H6ADžKHD$0H5s H5HD$0HCXH5O_HOJADž4H5c}H5JL|$H5!HLVHtHt$LHHaLH5H#HC`LH5%HHtWHH LPLL$ 1H52|Y^Ht$L$nHChHHSpH5=HtF AXCpHT$H5lHHtHT$HLADžCHsHH|$HADžHT$(HtHt$ HXgADž-HuADžH{HH5֏HIXHpLWIH5{1#fL9<1ɺr1H5zϹHL$8dH3 %(DHH[]A\A]A^A_fHT$(H5\HEADžHT$ H5 {HFADžHLVIH5Oz13_fD1ɺuE1Lb;H5z2LI;1ɺo1H5yE1ܸCp]Cp+ L'IH5y1脸HkX(IXHAsHsHH=lsH LIH5/y1HkX7I`2HE1uLa}{IH5x1ηfH8LL}IH5x1葷@H|$C`HH1PLL$ 1L}H5Ux@C`_AXLy91ɺ1H5)x;f.HxL|IH5w1Ѷ@L91ɺ1H5w觶fHL|IH5w1q@Cp@HL\}IH5Ew1)U1ɺE1L^8H5w.HE1rHL|PLL$ 1H5vĵXZȭUHH5EwSHH?$?HH@ Ht8t=L Sw11LF}7H5evPH[]HpH=vÀۅuH}H57>HH@ HtuHxu 17L vL|H5u轴H[]@L VvL|1۹7H5u腴07L hvLC|H5luWfUHHH545SHdH%(HD$1H@t1H4$H1ÅtOHL$dH3 %(u^H[]ÐLv1wH5tʳLu1|H5t蜳襫DAWHAVAUMATUSHHHH4$(L$L$dH%(HD$817HHHIHEHvI4$LH ADžMd$MLLADžAIH IFpHAoEhILAFxAoMxAADžH5tL@t!IH5tL{>ADž`L|$ H5FLL>LH5!3L>LH5L>IH5[L>ADžIH5LV=ADžHT$0H5LHD$(HD$0=HT$(H5L=L|$0MH|$(ML I HT$H5L>tHT$LHdADžALHAdžIdžAH$IF`2EADžAAHLAA!G+L21ɺ1H5qE1脰HL$8dH3 %(DpHH[]A\A]A^A_fDL21ɺ1H5Qq7DL1x1H5&q f.1E1L8rH5pٯP@Lw1H5p謯#1ɺE1L1H5p~fHT$(HLE171LkyIH5Lp10Lax1H5p{Ht$ H+IFPHLwH5o輮Ht$ HIFHHeLwH5ot>Ht$ HIFXHQLBwH5Ao,*Lw1H5osLIv1H5ṋCL 01ɺ*1H5n蟭LHT$m/HT$ H5nIL:w1RAW^HD$@IHD$8IY^IL/HLwSI1H5nXZyAWIAVAUATUSHxH$H$H|$Ht$(H$LD$HuHD$ dH%(HD$h1H}LuMpHx LH!ŅHCPLE1Lt$0o@hoHxHD$HHD$K#HSXt AEHmHxH} uLeD$DM$HT$H5G1Lx7HT$LH5`L\7HT$PH5VnL@7uD$PHT$TH5nL 7uD$THdHT$`LH5HD$`8Ht$`LIHH{XHH|$LaHLLHD$8LT$8IB H@ HtHt$DLLT$8D$LAzt$TT$DHE1LjjjjVHPRjjD$$ƧHPHHH@H@ H@(HtHHL$8HT$ LHL$8HT$XH5LHL$87HL$8HHH9tQ 9P v9P wHH9uA$HHL$89HL$8HAHSXH@ĀtHH HSXt΀HSXtHH HSX t HHSXqALHL4tIH5mj1QHL$hdH3 %(VHx[]A\A]A^A_@HsHLMLtH5j_AXLA+1ɺ71H5iרL+1ɺ1H5i1譨WLt$0HT$`H5`kL4D;l$`1HzHHL$ILctHHCXqHsHLMH5 iL(sY^@LXj1H5h货LKHJ1L!tH5h耧HL4sIH5eh1IL@LrH53h!fLri11H5hDL s1=H5g輦HSxH5dL-2ŅsH5L4<HD$HP StKxHt$(H|$/HLs1ɺIH5@g1$HCtLMLp11H5fLKHL(rDH5f躥DLQq1H5f茥HT$XHLHL$8/HCPHLKqH5OfLsH1)XZ*fH蘿LqDIH5f1fDL1'1ɺRH5eɤ@)L׉LT$8L$Lt$TT$DLT$8HHHL$8HL$8fDL&1ɺ1H5ieORf.HStH50L/StDƀHw%H8HSXefDL1&1ɺH5dɣ@L &1ɺH5d衣@L%1ɺXH5dy@Lf1H5fdLOH追LPp1ɺIH57d1H@H5eHxHHSXHlH@HSX\AWAVAUATUSHXH)Ht$HT$dH%(HD$H1H8IHmH#H} uHULH=e詣HHVHC;HD$jIH]TIHHmHT$0H5H.tHt$0LHCHGL|$(H5YHL.tHt$(H|$HHXLH5.Hf.H{hHRHS(H5aH-aHt$@H HT$8H5H.YHD$@H5 HC`HH5H,HH5cH,HH5cHs,LH5Hy-LH5H_-tTH 1LL$8LpH5axY^Ht$(LSHCXHHLH56cH+u ǃLjL L cLAVATUjSHL$8HT$@Ht$HtH0wHT$ H5H4-tHT$ H|$H UjL LbLAVATUjSHL$8HT$@Ht$HH04jL ~LbLAVATUjSHL$8HT$@Ht$HH0'jL SLUbLAVATUjSHL$8HT$@Ht$HH0jL LbLAVATUjSHL$8HT$@Ht$HRH0 HN+LLHD$HtVHHKIHt$(H|$ɻHHfLHL@H1膡HL$HdH3 %(H8HX[]A\A]A^A_H5HD$@sLL>lH5_Ht$8H|$!HHLUlH5^话:f.LLk1mH5^uL!o11ۺ)H5d^JyLLkH56^L`1ɺ.1H5^Lj17H5]͜hH|$(CPH1ɺLL$8LkH5]腜CP_AXL/j1@H5l]RL*LLjH56]LLjH5]yLLjH5\KHLiLL$@IH5\芛AYAZLLikH5r\XLLkH5D\*LLkH5\LLkH5[ΚYLLkH5[蠚+LLkH5[rLLjH5^[DHLiLL$8H5#[XZfAWHAVAUMATUHSH(dH%(HD$1Ld$`趷HHH蝷HCH`H胷IHGH{LoPHpI4$L{H蠶IGHHM|$MHCLHx AHCEEHPPH5pLoBhoJxHT$H%tHt$LcH'ID$HHH5:<L:'t)HT$H5"<L$HCHT$HPXH57>L&t)HT$H5>L$HCHT$HP`I^ILA8fDLj1H56YHHE1讲HL$dH3 %(D_H([]A\A]A^A_HLHH1A!LiH5X譗XZf1E1LBjH5Xyf@LIi1H5fXL+L1ɺH56X!@LL$LOi-H5 X@LL$LWi5H5WL1ɺ(H5W蝖|裎AWAVIAUATUHSHH5XHHdH%(HD$81Ll$HGH;LL`"~Ht$LqHE8HHHuH[HH{ uH3L1HEHL{H|$LÅ!foD$foL$ Hu0LEMÅLH5%L8"tHt$L跲HE@HLH5L"tHt$L臲HEHHHUPH5L ÅjI~L LjLX11jAWUj_H0ugLX1ɺLH5UȔFfDH5 Ht$vLM01LbH5U耔HL$8dH3 %(<HH[]A\A]A^A_LMF1LdgH5MU3뱐Le11ۺ&H5$U LM81LfH5TؓSL1ɺ+1H5T1譓(L1ɺ 1H5TL1ɺB1H5sTYL1ɺ>1H5MT39fAW(HAVMAUIATUSHdH%(HD$1H\$PְHLI轰HID$HH[HHHTH5TH IH5&HL @LH5XHnLH5Hu`I~hL|HL$dH3 %(H[]A\A]A^A_@1LG1ɺDH5Rߑ1H4$L HEXHuLe`H5R衑d@LY1ɺNH5Ry@HH5SHzLY1ɺRH5HR3fDH4$L\HEHHLSdVH5RH4$LHEPHyLKd[H5Q襐R1LRIH5Q|1N耈AWAVMAUIATIHUSHH*IAD$LH?;HHCH[(tcpHSLHJHsHCHXAD$LH9;HCHHsLHuID$HsHxP?H5HSMLHJHΏsD$ L1ɺMLcH5=P1!E1HD[]A\A]A^A_@MLc19rA@MLbf.MLbsMLbSD$ L1ɺ H5wO1[DL$ 3LKHGLbH5>OMLDH1AWXE1Zff.H>@HHHHWHHPHff.f.HGHNH9uHHHH@H HHBHgSH^ HoLHLH[Lff.HLVM2 001HfAWAVAUATUSHdH%(H$1HLVM2 001H^HFHo HHWHHC W@HooH$HHD$0KHL$E1WLH5HH$HC(H$UH$LHH5HHH@H$UL$HI$ID$ID$AD$H$HWLH5HAD$ID$H$UH$HML$HH@H$MuE1I|$ AAHC(H*1H{0)ω)HcHHHO(H0II L|$L-E1E11Ll$MM1HD$ Ll$(Ll$UE3H`HTHD$@1H$HlAHD$8H$H$H$HLT$xMd$ L$tt$pI LD$hL\$`T$XLL$P{UHHD$HUHAUL$ART$hRt$(L$APLK`RL$ASt$`t$H$QAWt$xQ $$$$VSHH_$VH5 _$ $8ATj$XL$I AQI1jS$($虉HAH$dH3 %(H[]A\A]A^A_f.H{PHKHII 1HcHHLB(HR0MI H I L-kL/^IH!^HT$H H L=^H|$H=^HL$ H jHL$(H|$Hs0H HD$@H Ht$8EH]H$HHqjH$H$H]H$fDL-~E11Ll$MBL=~E111HD$ MMHD$L|$(L|$L|$?fDHLT$hL$`LD$XL\$PT$HRHHRHfAULT$pH5\IHiART$XRt$(LD$xAPL]RL$H}ASt$`t$H$QAWt$xQ $PHm\$jPHp\$jP1RjjRjjRS$ HuDLA 1ɺlH5#\نƄ$?@HLT$XL$PLD$HL\$@T$8QHHQHFAULT$`H5[I1ART$HRt$(LD$hAPLu\RL\$pH|ASt$`t$H$QAWt$xQ $RjjRjjRRjjRjjRS$ HHQH褜L[IH5[1ͅ1C}HLVM2 001H9FAWAAVIAUIATIUSHHHnHEHD$1҃{<MHL1ڛHHH@Hz(H$HC(H߉<H7H$+HK HMt$ILY^AFdAt>LU}Y^-H<$QL$ L4U1ɺYIH5R17}D$$D$$H $HA@HLT1ɺ+IH5=R1|D$$D$$臓LT1ɺ\IH5R1|D$$D$$wtff.ATIUHSHHt2 HHt`LfHHn[]A\fD mL5UHHu1H5aQ|1fDL UDATIUSHH+H9u 'HHHHnHEI9u[]A\ff.AWAVMAUMATUHSHHLhHIHLLT$ЕLT$HI?8L貕H^IOfID$IL$H(LpLhH@@ H@0HAD$ H9t HHH;)uT@HpH9.tGHH9ut$PL1LHH|$XtHT$XL"H[]A\A]A^A_@AD$ DHkL}SIHtf8HD$kHL-H5UO zLL$Ll1lLS 1H5OyH1[]A\A]A^A_ùL,H5Ny1fATIUSHH+H9u 0HH{TlH<HHAlHEI9u[]A\UHSHqHHtH=HkHHH[]@LQR1H5+Nxf.kSH|qHHtDH=L 1ɺ(HC L)H5Q1LK(HC`exH[L1ɺ"1H5Q?xf.SZ=~c= HEBbuXbHH‰޿cHHǏCHHtj[@ HEB t`HuL%Q1ɺH5p\}w1&sH@A1#L QH51\9w1[DL \H5\w1[f.USHHG`t?kXgC`tnn{TRfHCTH[]fD[LPAIH5~[1vC`kXgC`uHLzPHIH5A[1GvH1[]fDmHߋ(ٌHO1UIL)[1H5ZvXZ/fUSHHPkt H[]DHH[]lAWAVAUATUSHdH%(H$1HHGaVkX HD$E1L5ZHD$ĀOA@L-DH1jADžlu AĀ6HS8H1ɿPLOH5YHIUH I%A кP1tH HH HH HHhC`3A@M<DHT$ƿfHC8x H9D$8HHIH %LgOH5Y 1R#P1tYD^cE@A@L-'YDHS8HL|NH5XHIH I%A кP1s_1AXH$dH3 %(Hĸ[]A\A]A^A_fDDcTHLMATI1UH5-X:sAY1AZfۉL_MIH5W1sc`r1JfH舉LMIH5W1r1 f.K`DD{TiAătHH-H1ɺ7AWI1LWATH5IWAUOrDcXH 10LXWH5WrDauCT1c]i8f2I1PHyL)PH5V1qXZiAWAVAUATUSHH $HHt$PHHT$XL$HLD$hH|$8dH%(H$1H$HH$H$HHD$0H$LLAH5V1qD$LD$dD$`DHCE1H8._HD$XL0M.LL9%I~G`%G`L|$XgIF1҃ApXHCH8^HiH<$HLIUM9I}G`%G`MIuuI~IVLUH5UHR8PHIH I%A кP1oAYHAZIFIULH` M9tI}G`%G`_DE1LUH5ToL$IMHD$L;<$HD$xHD$ DILTIH5"T1(oID$`D$LO` H|$xHtaL$HuIGpXHنCH8ILH|$0LLd$I$ML;$$HD$IGLD$ 11HD$xpXHxCH8] HD$xH$H|$HpHHb`IH_8oXHLIHIHH UH5R 1RSmIoDŽ$H HD$Pe`Ht1HHH|$8mLd$@Ll$E11HD$(HD$HLABELONEI9EVEMeI9HS1H5NRATILdI1(CmY^HIHuH|$Ld$@Ht$LD$(LL$tHM`H|$8HLH HL$PDT$tHHEzHI1PLI1H5QlAXAYIDLTRIH5gQ1mlD$dD$LfDIuϦUA;E#EH9BL I9I|$HLHuM$$H9BI9ufDH蘂H71PI1LPHH5PkXZEdID$H\$(AHD$Yf.H8HLXGSI"H5QP1\k_AX@kL1ɺ|1H5P"kDHLYG1ɺ-IH5O1jH|$X\$LLHH5OSD$lPDL$p1jXZHD$hHtHt$0H|$XH$dH3 %(yHĸ[]A\A]A^A_HHLFSI;1H5OjA[X @軀H1SIH5NLF1i^_>H耀LE1ɺvIH5N1iHfƅCfDH(1L!OIH5NN1TiuM`@HLE1ɺIH5N1 iHfƅ`@HH=6B HfATL%s6BUH-k6BSH]L9t.HfDsH}HP(HHn[HHL9u[H=+6B]A\ATIUSHGHh8HE[HxYHt/L`HHHxt`HH=5Be[]A\LE1<H5Lg1L+1ɺ^H5Lg[1]A\ff.ATUH-b5BSHZ5BH9t-IHH9t H{L_uHC[]A\[1]A\ÐSHHHHP H[2ZfU(HSH_HHtHhHEHHPHH[]ÐLL1H5Kff.ATf11USH0dH%(HD$(1I)$LbH] CAt$LdD11t$H5SKSZfHT$ H H9wTHD$H9tJHD$A1ɺRHD$LWDH5 KPP1fHT$ L1aZYxXHD$(dH3%(H0[]A\3]H1ɋAH5JLuC>P1e^_@\A8t+LDD1ɺY1H5jJreuDLC1ɺW1H5?JGeJM]ff.fH }CH9tHE11QH1ff.fAVIAUIATL%|CUHSI<$t]H]H9u -fHH9t#HCHt@atpXI<$HH9uE11HLL[]A\A]A^@;uDAVIAUIATIUH-5|CSH}tmII9u>H̀A`L9t-HKA`tqXH}HKHA`̀A`L9uE11LLL"[]A\A]A^@uDHtGauH{CSHwXH8H[AWL}IAVH5^HAUATUSHHxdH%(HD$h1Hl$ Ll$0D$D$/cHgL_HD$@HH$NHD$PHHD$<HzCH8HAą<11xIHLHuIHt-^[HtLpHHʼLLx1LrAH51OYH8qCsXH8MH5C`H߀̐C`[cSG`HtĀt̀H߉C`[<@oLQ?1ɺIH5=1XHpCsXH8HC`H߀̀C`[AWAVAUATUSHHDgT貳JH߉ oHt8/tnCTHHS8Lw8H56=PCXIIPHAH % кP1XH H[]A\A]A^A_DS`cDkTDsXAAHǺ@1LAŅ8{XO&{TGK`kXHDkT nH1ɺAUI1L8ATH5<<U>WH 'DCTHHS8L7H5<1PCXIIPHAH % кP1VH DcTDkXDD!HamAUL71ATIH5~;1VAYAZrhfDkXHmAUL7UI H55;1;VYD^EŅM8JHHlU 1IH|1PL 1H5:UXZf.΀H߉S`H[]A\A]A^A_@HXlHDLb6AUIH5r:1}U_AXgDLDsTDkXHD lHL@6AVIAUH5:1AT'UH fDHkHDL5IAVcKLD{TDsXHߋ(kH1ɺAWI1L6AVH59UTH AVAUATUH-~lCSHH}HIsXII΅x%MLLRńt1[]A\A]A^fDHsXH}HjAUL6ATI2H581SXHZ+[]A\A]A^H1jLF:#IH581SQf.H1FjAUH5v8ATIL451+kSY^ @AWAVAUIATUSHH8HT$Ld$LdH%(H$(1`HHH1iHHFL91H57RfHH蕑IHt-~KHtLpHLHiHqjCH8wL$91H5K7SRL|$M9H\$ E1D@HLIoHH^HٺHa1HC HS(I3EI3UH HC0HS8I3EI3UH u{IGHt$HHLl$I]LM9t{LIDHHL9uH$(dH34%(H8[]A\A]A^A_f.HHM?M9fL>71vH56 QŅzL:1ɺ1H55PH1fL21H55PHAUATUSHH $HdH%(H$1HIIHHLg1HٺLmMtAEHLABELONEH9$HLVM2 001H9$MtAEfo$ fo0A$A$H$dH3%(u~H[]A\A]ÉL1ɺH5G41MOL{fL1fLo11H53Om Gff.HHыwXHHfCH8aNHfCwXH8*Df.UHSHHdH%(HD$1HT$H$D$D $D$AAt.==t/HLq01ɺP@=t4=tiH1ɺPH52Lv01MY^HeCsXHH8DHD$dH3%(ulH[]@=tHL/1ɺP1H5v2~MXZDL1ɺH5D2QMZEf.H%eCwXH8Df.AVIAUIATUHSHSuZL%dCI<$MHtC`t ĀsXx@I<$ILLLńtHI<$?ń[]A\A]A^DK`HsX@HcAVL/AUI[H5711=LXHZHk[]A\A]A^HbL21ɺGIH501KsXI<$HK`H@HpbAVL.IAUcSH1FbLZ.AIH5i01oKf.H1bAVH560AUIL,.1T+KY^@AVAUATUSHHVdH%(H$1HHxLNHLH HH=@I1I@LLHLL$HHLABELONEH$HD$ PŅIt$ϦxDt$HkLD$ aAVL.1UIH5./14JXLZjŅH[LH HYLLHL(L!1ɺ1H5.IH$dH3 %(H[]A\A]A^fDH1jH5].1L,\IY^_LF01IH5.1"IfDL_L/IH5-1H-@L1,11H5-H@AVAAUIATIUSHޝuyH-s`CH}HtC`t Ā*{XKt%HsXEtCH}ELL It?H}:H߉ń&[]A\A]A^fDH}LLHuH^AUL+ATIH5,11GXHZjH[]A\A]A^K`H!H1^AUH5O,ATILE*1DGY^,DH]L-1ɺIH5,1 GH}sXH]AUL*IATfDH1n]L*IH5+1Ff1DAWAVAUATIUSH(dH%(H$1]L*1ɺzIH5&+1,FLD$I$D$1Hl$HD$L-B1@HIHI HLL.HLABELONEH9D$uEH9\$tiHHuH$dH3 %(D$uH([]A\A]A^A_MuM9uDM6M9tI~HHHtL[H1ɺSIH5*1L)EY^LLrtnH|$1L/H8H+fLx[HL()SIH5)1D_AX@L8[HL8)SI1H5T)\DXZD$DLZL+}IH5)1DpuH{8H u>HH{tH<$u1HT$dH3%(uH[]Hp*tE:DSH5F)HdH%(H$1HL;tS91DAu(H$dH3 %(uDHĠ[f.H1ɿH(L^,PH5(1AXZ9f.u7S(=5uO0u=[L1ɺk1H5N(A[Ļ=c81ɿLL(Dh1H5(@=R0t@L'1ɺb1H5'[@fDUSHD D=EAt11L'1ɺCH5'`@1H[]H=b'1 5Ņxwމ4u-ܺ=H[]/t`7H 'HL'DQU11H5'?XZ1H[]D7H&H1RDL0'Iff.HH5jH=D':HtdH|8u01L7'1ɺH5~&G?HDL1ɺ1H5N&?DLY1ɺH5#&>1Hf.SH5H=&l9Ht?Hǻ7u[f1L1ɺH5%>[1L1ɺH5%g>[SH5=H=o%8HtWHǻJ7u[f5H1ɿH7%D1L&RH52%=XZ[DK5H1ۺH $D1H5$QL%1ɿ=Y^[HH=%P/u H4H1ɿHb%L%RD 1H5$[=XZH@ATH5,UHH=Z$SHdH%(HD$17H1H9HH$3+I[/HMHMAH_(1,H9u7H߻5ufHT$dH3%( H[]A\3HH #H5#QD1L$.1c<Y^3HH f#1QDL$11H5Z##<XZ^@s3LW$1ɺ#DH5(#H1;H=#-ÅHH"11PDML $1H5";_AX3fDAWAVAUATUSHH $HH $HXHt$HH5,IH=l"dH%(H$H!1D$<HD$XD$@D$LD$P5HIL#11ɺH5"H$L5#:HEHD$`HD$hHD$pHD$xD$HD$LH=}B,H+1H=^B#HL=TBtƾ L0HtLLH=#LH="L H="L! H="L H="LL"LLAAEE1HL$`H=QB$HD$`HT$xLV"LL$hL\$pHHT$tHL€UMtH="LfMtk1HL$PHT$LLH5!,uKT$LD$PHHH HH!H H H HH!H H$H|$t8H|$o+Hv(HD$x-tHpH.1HHD$ HǹHHt$D$XLML-!MPD$\H5PHP17H L\$ H|$LD$!DHT$TH5D$TH=B+u;D$TL#1ɺH51\7AEL\0T$At AEbH$H!dH3%(DHX![]A\A]A^A_fDHT$XHL|$XMtH5BL.]L"1ɺ1H56H|$X)AEL/>LD|$/DT$HE1.HL$HHT$DH5H=6B3*DL$DAH1ɿjL!H5(jD$`P15AEH L. @11KIHSD$AϦH$@DLH]tIHqtLH HtLHMtLLHH+H H!%tDDHJHDщ@HHH) cD$AVfD1ҾHIHHH=B, H1H51AWL BL@!{4Y^AE@LP'HT$XHFL|$XMtH5,BLM,tLB 1ɺ_fDLJDL$DLH=~"fLH=Gw"fLX>La1ɺIH51'?H=7H1H5D1VLzH5a/'XZR3@ufS11HL\~H5&tBu1-H{gtct2[L1ɺH5 &L1ɺ[H5 X&L1ɺH5c 1&y@Lq1ɺH5;  &?@@ufS11HLLH5 %ftbtyu1tH{Btv[@Lѧ1ɺH5 i%L1ɺ[H5w @%L1ɺH5S !%c@La1ɺ[H5/ $@ufHGt HfD1ɺHLH5 $DAWIAVMAUIATIUSHHhdH%(H$X1Hl$0D$,H~A$@tx0E1H$XdH3 %(D|Hh[]A\A]A^A_ÐHD$@H5 HHD$225DHD$At0H1ɺH LcPH5 1#_AXHT$H5Q AHD$DA2uHT$,HH"HDL$,EL11LF~H5" "H#Hru#A$~fDD$L? 1ɺ?H5 1"DL$LfL 1ɺ11H5 O"A$E11ɉD$L 1IH5J "DL$tuu!DL$HDL$A$fDH1ɺHw H5PLv 1!Y^-@DL$&DL$tD@1ɉD$Lk 1XH5K!DL$u!DL$|DL$A$f1ɺqD$L H51 HHKDL$HDL${t]11L H5 DL$u!DL$4DL$A$%L$1{TLHHCXHHD$H</@/HHH9D$s&L HD$HL$HZH9uL>HD$HH\$0H9uHH9Ht$HuIEHHD$HT$I9DHxzHt~Ld$0HXI9u nfM$$I9tcI|$HJuMtMH|$Ht"A$<-ttI$u!H\$HyHL-yA$HD$HHD$I9t!HT$XD$L 1ɺi HD$HHHELfzLA[zSL 1ATAH51TXHZLWzH|$-AIEHHD$HD$HT$I9HD$HflH|$pHD$H2IEHHD$HT$I9hH|$IEHD$HHD$HT$L99H\$Rkf1EkDAUATUSHH $HH= dH%(H$1HAÀۅurHIH AIH L DLjÅH$dH3%(H[]A\A]@I1IH \AH; L yH71UL 1A1L; H5 GXZuH21UH5 L AL Y^>fLI1ɺ<1H5 DUHSHHHl1HHFHCH&HCH HC RH=FAHH;to@H=+AvEH=AZY11_Eu H[]fH=Azup1ۃ8H[]I1L QH5s H[]fDHHH=; tH Bt#r Bu_ Bf.O Bu = B6 BtBHC BS B B BHt#Ѕt Bt[Dt/x[٘fAUAATAUHSH1ҾH1ɺEPH5 Lb lBD-ZBMBD%?BP1ATS`H HH==BxH[]A\A]H= TH\1ҾH,1ɺEPH5. L BD-BD%BBP1ATjH 1HH=BZ1L% H5l1D -BH[]A\A]ff.@&Btf%3Bff.@AWIAVAUIH=ATUSH(dH%(H$1LÀdDBAELd$LLa yD rBEt:DCBE=@B5.BDt,t1L@見AfDL蠋AH$dH3%(DBH([]A\A]A^A_fDA)B BBu\At Ds1DLLxBDL OBtDL1H5a#E1D$ M1LKH5DT$ A tt@D$ 1ɺ1LH5uBDT$ tlDT$ WNDLDT$ OfA tF11LH5c%DT$ NsDT$ Ly1H5L1H5 fSHH=IЃɹEu51H5HH 4I E1[Me]A\A]A^ÐAٹLH5 @L11kH5E1DHa=L |@ALN1E1dH5~IfAL11}H5RGfH=L ff.SH5lAHH~u 1[fDH5YASH~tߋSH5OAH~~[@AWIAVAUIATUSHH=HH9H6=H9H=L5H9Aą H__D9t+P1EULZH5XZD~LHsH;,AVH;/A9H;2AIEH[]A\A]A^A_@1LBH5|H1[]A\A]A^A_L5Aą8HMLPHeAPHƴP1H5H 1H[]A\A]A^A_DC8A>MH 5HwH5HDHLCPHԲP1RH D#F8/A>MH HHDHLPHpH58P1R$H Dk8A>MH XHHDHLrPHc H5P1RH L5%19fH A@HA@HA@8$A>H HHDHMPHƢLPRAUATAUHH=_SH(dH%(HD$1AHt6H11H5<,yHHIt$DL$Hp1H=/A*Y^AH-AfD38HL PHLDPHPH5P1H 84}IH H HDHLPHHH5=P1R)H {8 L 1PH3LPH51XZL1ɺ1H5Af.=AufUSH=HHHt/8>t71 H9uH=Au,uAH[]fD1Hx 9~f{8==AH mHHDHL APHPLmH51R4H mfSHLL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HAHtxAAADHAHtfHoAH$IHD$HD$ HD$$(D$0qH:AHD$dH3%(u&H[ÐHq =HyHa =Hff.@fo$Afo ,AHfo1AOW DoD$oL$oT$()A) A)A@H=A@=AD=ADH=AH5Aff.fH=AH5Aff.fAufHHIjL H HjH=PHhRH1PHfVH56P11HHff.SH5%HtSH5GHt;H5gHt#Lg11H51҉[f.fSH5f]HHdH%(HD$1lD$HtgH@ H@XHtZ1HT$HЅtJD$H Iٹ 1LaH5>P.fDL1ɺ1H5Hƪ HL$dH3 %(HuEH[HL11ۺH5HatHratH{aHESHLHt[fDH{ L5IH501@Ha[HGH@ t/HB^u'@u"HHqqHu4H\H@t LuHAf LtHDUHSHH5~`HHAuEH[]f.H5?`HuEH[]f.H5`HuEH[]f.1IٹWLH51afUH?SHHHdH%(HD$1胗Ht~?HHnHt9H|$HtT$HL$dH3 %(udH[]fDoLH5'>H=HHe=`@AUATUSHHOHAPL HGH@HHAAuEuOH u^IEt~u2ALu.HCLHphALH[]A\A]ALH[]A\A]fHIHGXH4H ШunIDHLIH51 H1[]A\A]ff.HH@@\u f.HH0nLtHfL1ɺ1H5}Hff.AWAVAUATUSHHLwPHwhI>i1HIHHIHIDL,@mI HL9rM9H[]A\A]A^A_fDH`mI>HHjHHD$MI>HH$NHL$LIH51QHT$R%_I>LAX I>HH$HIH$LIH5-1R)AU5AY1AZM9HCPHH8HII>HIAULATI1H51XMZL31H5H1I>IHLI>HH HH5QSIL17QY^1H[]A\A]A^A_ff.ATUSHGY@uHCEŅtE[]A\Ð{1LIH1H5[]A\HL%Ht Hx+IH HPLATI1H5asXZ[]A\f.USHHGY@蔤HCXuH&rHf.HHuQH$rJH'rCt Hu2Hڡu&H.uHCXtU uNH8HHjHsHsLUI1H5g1wXZH[]@L1I[1H5#:H[]ÐHL:cIH51ff.@AUVATUHSHw?ukH[]A\A]D >@HI.HI!AUH5gATIL1fY1^?tH@HIHLATI1H5XZ1H[]A\A]AWIAVAUATIUSDHHHH$$HL$L$HD$L$dH%(HD$81AHHD$0詴1AuIHDILP?IL9LuADžAuH951HHHHP1H@H HDHHH|$0HuHD$0HLAVLL$t$LD$@ZAXZEdA6LAH_L01ɺIH51HL$8dH3 %(DHH[]A\A]A^A_DLCLLD$ LT$LT$LD$ AE LD$ LL9LT$LT$LILLT$(HD$;LD$ 1H5AP@L1AWLL$(1LT$8EUD_LAXADž`f.Lf1ɺ1H5}f.Lf1ɺ 1H5M_f.H5(1LwI1'AufDLE1HH5PHD$ LLH(1Y^)@HLLD$E1L$IL$LHL7AuLH(HLD$I1H5XAPLUSdH 1L*H5%<LLTLT$ LD$ AEAEAD)AIAVAUATIUSHHdH%(H$1HGPL(LHID$XH%r L@tLcHHhH5MLIH<H HLHpHWHcE111LpHHI<C] uhID$HxhH$dH3 %(HdHĐ[]A\A]A^fDLd1ɺH511IHKH1HL1LHLm[Lc1ɺ1H50BEDI$HRhHPh+Lic1ɺSDLQc1ɺ1H5fL)c1ɺ1H5f.H1&L*IH5o1DAWAVAUATUHSHH(H4$Lt$dH%(HD$1芒HHD$aI@LH AąHT$HBTHH=|QL`(LhhH:À6MUAKH#I+6;HE11ATLlH5TkXZEY=ALJ`HpAąHEPH8Aą* >HL[IH51E`EeE1fH8I@51MLH5z@H11AU_AX [=CNfDH1H5/E1ATL/1.Y^EYHL+1ɺIH51L9`1ɺ1H5HL$dH3 %(DH([]A\A]A^A_fH:AH LC1ɺIH5V1f@H$AALJ`iLy_1ɺ1H5;f.HxLD IH51H|$bAąHEPH8+AąHHL$IH5a1qALJ`H)mAą}L^1ɺ1H5-YLq^1ɺ1H53 ff.fAWAVAUATUSHH8dH%(HD$(16]HHCXH0H2IHCPE1E11ɺHH8ADžuvH~EHG] LNEHCPHkX,HH8XDHHsX,f.Ht$$HADž`HL)8ADžfHL`L6LHtADžH@LL0HD$H8HD$H HD$[H5 FHID$PH8HEHHAADžE11H1HADžA$HIl$X2I$L0MtBHD$H HD$H@HD$H8HImX4ET HHE111LH4ADžjHLO6ADžuTL[1ɺ1H5UgfHLY1ɺBIH5$14Hl6ADžHYAADžNA8fDHE1uL<IH51HT$(dH3%(DH8[]A\A]A^A_LZ1ɺ1H5mDLZ1ɺz1H5EWDYLHLl_IH51>@HHL`55ADžZLHqADžL @ADžL Z1ɺX1H5LY1ɺv1H5ewfLY1ɺJH5:Q~@LY1ɺ1H5'TfLiY1ɺV1H5,f.L9Y1ɺ1H5f.L Y1ɺ1H5f.LX1ɺT1H5]of.1ɺE1LXH5'>kfLyX1ɺ1H5H@PH8IH{pHGPH5=;L LTD$HtH@ H@XHtr1HT$LЅtbD$1A LH53E HCHhX;H11ALH5H{[L7IH511yDLHxH5:HPHGPL L+D$HtH@ H@XHA1ɺ1L"H5,1AL>H51fDHxGfD1A L/H5AWIAVAUIATEUSDHHHFPH|$HH@HL$ DL$HD$(HFhHD$NHHH@HD$8ZL$H$LEH|$DIGP,M4I9DHD$0HD$ HH=7HL$ HH91HHHH|$HH)HHD$ I"1M)LH5'@113LT$ MgM1LHt$0HHPH @LH HH9HGH9Ht$H|$I)1HLHt$0H9H$3H$H|$(HD$ HH$H$H5H8THH|$(1HZIHLIBHu@H@HHP :uHrL€uLHLT$]LT$Lg@$D$Ht$H|$$fDL9 H5t1E1HHD[]A\A]A^A_H\$IUhCH҉ALHt$H;A7fH1HHLHH)*@H|$LIH51E1VHT$H|$ÂHt7HHHt.H\$HH{t H{ H[HuH\$fDE1LLT$LIAV1LSIH5.S1AW;H LH1ɺATILH5t$0D$4P1H HD$8LT$@\t$cAE\@D$DeTAHDžHHD$ H H(L0HPLXHDž8HDž@DH|$I1ML6H5@11'HJ1HHM fDD$L5J1ɺH51DL$@QLH1ATAMH5XZL`BfDHt$ H;苿HH|$(1H\$HΉD$VIHH~IDL 1ɺ1H5LT$L+11H5ϾLT$H|$HSIK1M#LH5@11MDHT$H|$@f.USHH(HGXH-H4s=HL<IH5N11\H([]H,HHCXHCPH8X*ŅfHsX,H)$)D$D$ jjt$t$qH ŅtUHCPHH8*uHZL)IPHHCXHLIH5a1qw@HL\IH5)19H([]AVAUATIULSHdH%(H$1IH<IHLHuL+B1ɺ>LH!ʁ tH€DHHHD@HL)DpLLmHAr~HxHH$LHH)HKT5H)DJT0HHLH讏ÅH$dH3<%( HĐ[]A\A]A^fDAEtAUtCT5fBT0IH1H\LԫL@1ɺH511yU@L@1ɺ1H5O+f.L@1ɺ1H5f.AUCT5BT0fDAUIATIUHSHdH%(H$1HHHH!?H=]HD$@KHD$8HH>E11HHLL$|$Hu_HD$PH|$8HI$HPIT$HPH@IT$ID$H$dH3%(HĘ[]A\A]@HpHZLPDL$X1H5`¼XZH|$8&1fLJH5'莼1fHLOIH51QHLTIH51Tff.@UfHSH8dH%(HD$(1H)$)D$t.H$EHL$(dH3 %(u5H8[]fL=1ɺrH51}膳fDATUHSHHwHLgPdH%(H$1HHH5gHHts1HL;t HH5Lp HI|$HHteHEHH$dH3%(HĐ[]A\fDH Lq1ɺIH51|f.L<1ɺH5Q{@LMH1ɺLAH5%O+ff.G[tUHSHHHu HvH1[]fDHHtHPHRXtH2rHH9XuH[]ff.HHH9t:fHPHt HJHtHhHt A[tH9tHH9u1@fSfHH0dH%(HD$(1H)$)D$1҅tHT$HD$Ht HH)H H9H\$(dH3%(uH0[辰ff.AWAVAUATUSHH(dH%(HD$14LcPHI$H$9D$HH@@LhMHLpM{HLHT$HT$AHsXLHHǂhQADžLDADžHuOL0HHH LM1ɺXIH51hH<$H"ADžQLj1ɺ`1H5μ0H<$HT$HADžDD$ELiADžyHkL1ɺvIH5g1ǶH<$H"ADžL(1H53IL1}脶H<$LX INXL1ɺH5IL1蠴#H5^HHT$4HT$AaHL(+IH51EH<$HkX,HNH<$蝡H5"HH<$HT$HL$H<$HHsX,{f.H(LߺIH5!1E1~fDHL$dH3 %(DH([]A\A]A^A_fLI11H5ʸ,f.HLTIH51t@L19H5bIJG1ɺE1L4H5/薲HLIH51a@HL,IH5ɷ1)H<$HADžfE1L1[H5zܱLd:WL!1EH5B褱'1ɺE1L3H5vHLǸIHLIH51@LH5H<$HADžHOLIH5H1訰+HL,IH51q@H#LIL21ɺH5! LMH51E1xHhHLPPDL$$1H5X躯XZHH<$ADžHLIH51rDHE1HH5PDL$$1Lh/^_HL\cIH51|HlL(IH5e1ŮH<$HADžH&LIH51L1mH5VHL7IH5³1"L1yH5|HlLI?Lĸ1H5M语2LVH5!舭]LϷH5agUSHH.H߀ǀtQH{P蘄tH{P_L11H5{ݬH[]@H{PEt!H{P_tH[]fD1LH5|H[]H5HŅuHLIH5̱1,JAUIATIU1SHHGHK @CIu=H{8HtHS@Ht1MLntJuFH[]A\A]fDs41MLH=s[9uH{8Ht HS@Hu1L1ɺH5Ͱ/H[]A\A]s0J1MH=L+fDs,1MLH=euCHs(1MLH=8yuCHfHs 1MLH=rZHuCHHs1MLH=0ZuCHUHs1MLH=YuCHHH7IH=Y11CH@ŨHs1MLH=YuCHf.HHH9t7fHPHtHJHtHRXHt AZtH9tHH9u1fAWAVAUATUHSHXH|$(dH%(HD$H1HoXH|$(HGPL8HD$_*H5ϩLI_HD$HAD$LHl$ 1Hl$0HD@HHD$nHL$IHLL$AF`jE11ɺLPDE1D)UPHt$8kH HH9\$I$H|)LM3HH@H_HH5^I H HHHHBHH¸@H v!H@vH9L$ H%HHt$H1H H1IIHIA9MNHL11H5HKH9\$ A*Ly)1ɺH5E1H\$HdH3%(DHX[]A\A]A^A_H|$(VLIH5a1详E1f.H|$(LݳIL$LIH51ND$7DMNHL $H5DzD$LW(1ɺH5E1fAWAVAUATUSHHXHOPH|$(dH%(H$H1HHL$0HT$ ZH߉D$8&HHH@HP+DsLEAFE1D$IL9t$5KvHLxL%LHM+H|$(LxI!H|$(达L5IH5ɰ1E1H$HdH3%(DHX[]A\A]A^A_H|$(VLI1ɺD$L%H5H蝣DL$fD1ɺD$L%H5mDL$OD$8D|$LɯH5@萠1HfAWAVAUATUSHH $HLoPH|$ HH$@HL$@Ht$@dH%(H$1IEH|$(H$1HHHD$LtZLC"1ɺ1H5ٟD$0H$dH3 %(D$0uH[]A\A]A^A_@HD$ HD$0H|$ IXD$0H|$ HHHD$H@HP ALD$|fD$H1HD$H$HD$PH$()$)$DŽ$D$8D$<D$4D$xHD$pLHD$H$@H9\$fH)$)$DŽ$H@s HL$H[HHHhHH H@HPuHH@@O u}L|$MtsHMHH$@1HتH19I}H-H$IGHL,H5a趝L$LH$LHHx  L$M9H$Ll$XML$H\$`IƋ\$fD_HGPHxHNHpH9aB@HWP'Hr 1H>DHGP@ATUSHo@HHCHM1ҋpTHHDHHHCPH8H9[]A\]fDHGPHpHxBfDHWPBulH:tmH9zug1@HG@H@@trGpfDHGP@8u.tqHp HxA@uHGPHpHH+xAf.HrwAf.Gx@Hz(OAHpHx;AHAPH8,HSPIHEH2H@PH8H}HAT1SIL1H5OrXZ[]A\Hr0Hz @HrHz@H8H1AdH%(HD$(1HGPHE1H8t $tT$ H|$(dH3<%(uH8iff.ATUHSHH0dH%(HD$(1Ld$Ht$HD$ LD$ HD$LH5H谥tlH$T$ H H5PL#HgHD1 RLKH9qY^H\$(dH3%(D$ u5H0[]A\LA16H5pkhfATUSHH9t8IHHH9t HsLt[]A\fD[1]A\ÐSHC)u?HCXH0sH2s]H$r6tHHxXu$1[ÐH[*HhHxXt)HY[H@XHH[HH@HCXH$sH%Ht;H[Hf.HHxXuHCXMHCX1HvH铌SHHHtHH[1[@UHHSHLFHdH%(H$1HFPHHH1\x1HHH$dH3%(u;H[]f1LH5L|n1fUHS1H)u4HEXuuH"s/H0hHHt@HXHH[]f.H!rH.rH/rH&rH'rL11ɺ1H5mDSHH@H5dHtHpHH[׊ATIUSH=HtXHLHH'ytHH[]A\*@L1ɺH51m[1]A\f.L1H5̃lf.HHǰH9t'fHB@t HHu HH9u1ff.@SHHHtHH[1[@HHWXH$r-H0r& u61t HhHHHHH@HSHHHtHH[1[@HGXH-rH%s"H!Ht$HH@H@@u1fD1HÐSHHHtHH[1[@HGXH%rH-sHHtHH1D1HÐSHHHtHH[1[@HWXHkH%rHc@t f.SHw#u t H8[Hx1uff.H8HE1E1dH%(HD$(1HGP1HH8Nt*$t#D$HT$(dH3%(uH8f.b@H8HE1E1dH%(HD$(1HGP1HH8~t*$t#D$ HT$(dH3%(uH8f.a@HGX@uĀtAT1USHPHHCWL}HH葙 H9YHI.YHMdLHHtfa ILHHH1'SxH[]A\H5H\@L7}H5|11eL|1H5\|ef.HNPHH>AV1AUATUHSHPHH,VL|IHz H"XLIXHI XOd&HILHHtq< IMLHHY|1HQx#H[]A\A]A^H5[@L|%H5V{11dL{1 H5,{\df.HHv HtH@PHx ff.SHHHtHH[1[@SHHHtHH[1[@SHH@HtHH[O1[@SHHHtHH[1[@SHHHtHH[1[@SHHHtHH[1[@HGPHHxH@SHHdH%(HD$1CZtIHtDHHt7HpHCPHL$E11H8 ÅtW1ہ|$.L}11ۺCH5 y:bHT$dH3%(u+H[fLi1ɺI1H5xaZATUHSHdH%(HD$1茗AąE\HHHx[HHPBHLt0HH9jt:H 1f.HH;jt&9uLMHuL|m1fDHxHAąH$E1<AAf.Ht$dH34%(DH[]A\LMH\L{H5w1E1`LMHdL{fH@HjE1L{LHHuH1H5%wZ`XZSL1ɺz1H5v/`*5XDATAUSHHdH%(HD$1趕HHCXHGH H4HHHEH}@6H~AąHsXH TDULEHH!EB1H"1@H@tHH;\t0@tHH;\tDHHHHI9uDE9(H$E1<DAHt$dH34%(DH[]A\KHtHxXHDLKHLyH5ju1E1^LKHLzfHLOHsH1E1L zH5 u>^XZ7H<$DE1THALY1ɺ1H5t]LKHL5y%Uff.AUATIUSH(Hn dH%(HD$1{HHHEH8HEX #@cHEX C-}`tLDkHEX@tOHBCHEX%HHmCTh-fCHEXH%H$H-CCHEXH$H%o-CC-HEXCpHEXHH!HƒkC HL$dH3 %(HOH([]A\A]pHEX CwfDCtHEXH$RHuHHHWH!zHH-AT$HT CXHEXHHEXH%HHsMfDjA$A|$H El$EE\$ECsED$(Et A|$HHEXH%s A|$HH0s A|$H{rt At$$tCRA|$ྃoCwf.XXfC_f%HໃrCH4WH0LHBiMC^_DADLh1CH5|_BD$L t_SLiH5<_H8LD1uBZYGfDML$H1E1LJ_H5^f1LfH5\?17AW$fAVAUATA1USHHXHoPdH%(H$H1H|$ )D$Hf7HEH(HCXu}H\AŃu{HAyAƅEE,HtHL81ɺ1H[t^t#L1ɺH5U[1>1H$HdH34%(HX[]A\A]A^A_fDE1HtAC^+ffHC[Lv4Ld$HLD$}XHI"CH=R4MH &[HzH5 [HDEHDEHDH1ATLD$H=dZYHE1[D]A\A]DL1ɺ1H5V':HL^LL$AQT$8R PDL$L$uNH|$ HsHtLt$LL$HH<$LL$ִS PLc]LL$H<$Lt$諴H|$ LL$HHHt L $艴L $S L\AQI`*@HHHW E1Hv1Hz j1jjL$H(ff.@UHE1E1S1ɻHHz 1jUjH tH[]fHO1L=1ɺ H5N1H[]ff.H8t fDHHxHǰHPBu HË@Lff.AWIAVAUEATAUDSHHVH~D9w_I4AvHD,HHxIFAF9v0)HHLHHHHHHH9uAIIIPI5LHIIWPH0jIH5LIlMHHD$HSH$Hx@ GI>$LT$ARH5ML MLT$VAUATRPHPUL[18 H5L/H@L$ILJDLHD{HHx@xFI>HdL VMtH &QQAUATAWPRU H&L &MRRAUATAWPHCPULZ18 H5L\/H@IEfH[]A\A]A^A_DLZ& H5K/1L]1ɺV H5K.H1[]A\A]A^A_@KLX1, H5oK.D1LYM H5DK.19HD{HHx@"EI>H(L KH$L KRRAUATAWPHPUARH5KL KLT$VAUATRPHӬPUff.SHHQH@@t HHBH8t0H[HQHtH[fDHQHHL$HL$tHq9^v9^vHQHyAE1ɋJ ÅuL1ɺu 1H5IF-nAWAVAUATUSHDaEuQGtJHHL$IIH<$DxA@DEt0HT$HHHBH8tH$AD9`w@1m@HHH,$H]H9u5fHI~ E11j1jjfH uHH9tIELCH0MuI9uEuH[]A\A]A^A_fDAM Ht$E1EH<$LÅuLx1ɺ 1H5H,ff.AUIATAUHSHYHHHv趩HtHD[]A\A]I}(IHt%HUHHHPHD[]A\A]@L=IE1$H5Hc+됐AUAATIHUSHH赬H@@@u+HCXH$r0 uEu\tI|$uf1H[]A\A]ÐHhHxXuHYHMuHCXDH9ŅuzCYH(E1LVIH5>G1*AT$ t CYaHDLV1ɺIH5F1E*2HDLU1ɺIH5F1*I|$uAL$JAD$ wDAWAAVAUMATULSH(H|$MDU DU$E)A9DGMt E9UDELLMEIqDIy11҉ƉD$DD$D9T$FD$A|$hD$JEtXD$`E11ۃD$D$pD$H@HH ЋtF;]LsE;\$`v΀|$uNjD$pDL$pH(D[]A\A]A^A_f|$hDDE|$h+E 1HqMt$HA$$$P1AW#D$DE1PL$@H|$8H0-OAp@T$hHqH|$H$ڃ|$hDT$xu1ɺD$LRH5D'DL$@EUDELLMEJDT$D$[HEA@HHHE1E1$1$jjjH|$8H0AD$L11H5C8'DL$ZfD1ɺD$LaH5C'DL$'AAtEu AHDELA@H։L$HL$HHHLKH1AWLRH51Cy&ZE1Yff.@SHL %HH@dH%(H\$81HHL$H$IDH|$H LD$H$W!1EH"M}H! Lu HLH'L觢LxIGI @GHH[DID$XfDL|MTH5a= YfLJPHLH>vHALH$\H>LHBID$XD$ H0ZHLHID$X6fDHLHntHALHXL1ɺ1H5g<f.L1ɺ1H57<f.HKLHtH@LH L1ɺZ1H5;Lh1ɺk1H5;fHMLH^& ID$XD$ @H/KLH.tBHH@LHt,HLHtID$XD$ @L1ɺ_1H5:G#fL(d`ID$XH0 tHLHLwd ID$XH4kH-@LtID$XMutEH:LHHMLHD$ ID$XMuH`H}H(sAH>LH IuH;HD$ MuLL}Ht>LHHS;LHEID$Xt H$ A$ AD$^#IuHAHIuHHH}|wD$ M$M$M9 E1H\$E1LHl$LEIHEPH1ɺLHH58LuH1ZYM6I9IF@tA~LDEDD֐HLHtH>-LHL1ɺ1H58Of.HMLH4ID$XD$ H0>HLH|L=1ɺ1H57fDHLH6ID$XD$ @H*LHtHLHL1ɺ 1H56GL1ɺf1H56&HLHLI1ɺ1H56 f.H?LH~H9;LHdH7LH jID$XD$ HLH@L1ɺ1H55/Yf.Li1ɺ1H55Zf.Mu7LHiH3LH|$$ LHALHtH3LHL1ɺx1H51fDHl$H\$HuEErHHaL"1ɺH5m1eDID$XD$ fDL1ɺ1H5/1w"fHLHtHLHuL1ɺ1H50#fDLZID$X3fDH:1LHflID$X@L1ɺl1H5g0f.H@LHH$5LHD$ H!7LHH4LHID$XMuD$ fDH4LHH61LH\A$SH1LH39L1ɺH5?/hLɔ1ɺ,1H5/_L1ɺz1H5.>fH5LHt:H3LHt$H LHrf.L)1ɺ11H5w.[f.L1ɺ1H5G.f.Lɓ1ɺ|1H5._;f.HZHDd$DT$)EHu-DLa1ɺ1H5-!fL91ɺ1H5-f.H7/LH.L1ɺH5:-HuHHL1ɺH5,HH{LHDID$X@La1ɺH5,@H_LH^tH%LHHL 1ɺ1H5W,L1ɺ1H51,y$HzLHtH;%LHL1ɺ1H5+#MH,LH$LM1ɺ1H5+L'1ɺ>1H5u+YHLH&D$ Lߐ1ɺH5*+wsL1ɺ1H5 +QL1ɺ1H5*+HyLHtH/LH~HL?1ɺ1H5* HdLH>L1ɺ1H5M* ILُ1ɺp1H5'*o KL1ɺH5)K uH1LHLLu1ɺ"1H5) LO1ɺH5) L+1ɺ1H5y) H*LH*L1ɺ%1H59) 5LŎ1ɺ1H5)[ H1*LHIG',H*LHzL;1ɺ51H5( @H)LH62L1ɺsH5B( kH)LHIG@ kHh)LHQLz1ɺC1H5' H(LHt L51ɺ,1H5' H(LH4L1ɺ=1H5C' ?Lό1ɺ(H5'g HL(LHhL1ɺ/1H5&' H(LH(LQ1ɺ21H5& L+1ɺ9H5v& wH'LH,L1ɺ@1H5;& 7ff.AVAUATUSHr1H߾A1ҾHD,AƻD, txEA9EtU ݉   ݉ ݉!ALW611MH5e%D ؅u[]A\A]A^}1@1A1ɺSL*6H5%Y[]A\A]A^D5ALf5113H5$ AVAUATUHSHH9t#H;pufDH9pHH9uHIC"Dk H{I3"AV1ɺfAUI1H5J$L5XID$P ZHxf%Ht;@HHHXa[]A\A]A^D@[]A\A]A^ùLJ5iH5#1AUHATUHSHHH9H;stHH9H9kuCvCH[]A\A]f+!De H}I!AUL41ATI1H5+#sYH^IaH[]A\A]f ] H}I ATL4SI1H5"XZ1H[]A\A]AUATUSHHHLHL9t+HLatDeHEAu^H[]A\A]LaH߉ HL4UI1H5""jXZ1H[]A\A]HxDh HHHL 4ATI1AUH5!UH 1OD1L3H5!1DHGPHHH}SH=@HHtCPPP$H@HHHHt Hu[@L1ɺH5 11[øATIUSHdH%(H$1HHHID$PHHH9tvfDH{G~= HID$PHHH9uԋ4$t=HLuH$dH34%(uH[]A\1gHLI9tY11 u&xLv%HL9t!HPHPHRu҃uHL9u߅tzf.f.AWAVAUATUSH(HFPDd$pL$LhDD$CdLL$D$HHHLhAi IHD$LHHD$I IHHCD$I^InAF$D$E~ AF(HD$EfLIF0D$`AF8D$xAFP$$IA$AFT$A$AH$I[I~x[I[H|$htHt$hL:HCĀtHmX1tHMXH(L[]A\A]A^A_DHt$LIHLLLV1ɺ/H51E1DHuv$f 1E1L20H5Q=@Lق1ɺ%1H5'of.1ɺEE1LH5>fLLLn1ɺ)fSIщH@IHHHЋWPL讖HHCHt[1L1ɺ$H5_1[AWAVAUIATIHUSHLD$E|$ I|$IUL1AVI2SH51AW;H A9\$L|LD$H[M EXHI!MEXr@I$LhhLLÅtzH[]A\A]A^A_@I$Lhuz@붐I|$&Aٺ61PAD$LLO.H51P1vXZfL1ɺI1H5Oef.L11ۺ>H50DU4vSHHHGH@PHxHtEHCLuHkLH[]DH@HHHyH@H{L-XIH5*1p1ff.ATUSHGPHL A$@u G[HLhŅthHLiC\u[]A\H]ŅuHjLIH5}1뷐H8H5UIL|1HLhtHLZI11H5M[]A\fDLb,IDAVAULATIUSHALI WuH4~Ht L;`HME1jHLjjjjUjjjHPHBHKXHLUHÅ][]A\A]A^DLVHE1E1jHLjjjjUjjjJHPIH*HKX HLGUHCPHIHHxH[3|HKÅDL|1ɺ 1H5H#H|IH,L;`"hPh$hML$(1۹L* H5/[]A\A]A^@hPh$D1LW|1ɺ H5[]A\A]A^@ML$(L\*11۹ H5hHHtHfDAWAVAUATUSHH(HRH$pHt$`DD$HD$(H$DL$HD$8dH%(H$1HH$H|$('IHHOHIHIXHtHх%HSHH$xaA$HL$`D$ t$LHt |$ I $HL$#D|$Et DD$AvADD$D,$CD$@A9Dl$HD$@tDt$E<"D$D$HD$0D|$0H=IMw`IH6%LHIH&HD$T$HM~EnID$@AF $`AF4$xAFtHsH{սAF$H|$1Ҿ:谻AF@D$ D$HE$hAHCD$D9t$L)1jH50L$t$ HNlL$t$ $hHA2l$`DD$LDH|$W1ҋL$AF0AN,AVDCuAF$\$ AD \$ EL)1ɺH5GB;P1SA[[DfAL$P$xDD$H@@>"D$AF(>$D$AF0\$ D dEV0Et=H|$Av4EN01ɺPD$TL)H5P1AXAYD$ t$H|$0؅EA^t)D$0In`HI\p@HHOH9uHD$8H|$1Ҿ6IFXIFPHt#HHx E1E1j111jjH H|$1Ҿ7XAF<$AF1H|$`t HD$`EN$D9r AN( AN$vA)1DHD$hAF($AF$HD$`Ht HvHD$hI~HT$(L覠HD$0HHM~XMMM'M9AMnPInL|$Lt$H$I\$M|$L9UDH{vHH{IuLHHMtOH5DH, HsLH5 H5 fHQ HI9H5HQLt$ LH5 WHoLu1ɺQ 1H5.H|$0O$t+AV AVAV(9sA~t En@E-"$H|$h$t5Ht$hHVFLHBtt HCL$lj$HH$Hp $AF\$td"D$MD|$u I}P|$E L&w IH51EeEueAEAM1+$A}$AmD$1҉AE 1uAM,tAM0ډH|$0HH+H9$H\$hDŽ$AMAUD$(D$HH$$AE $tHD$h9XL D$ |$ I}Pt $$t$H$MAH$IŐ+D$(D$IGXHD$8H$D$DŽ$t1H$HHQH fDHHHH9uH|$0HHhH9tK@HELuHXI9t'C 9Ct CH蕟HCHXI9uHE HhH9D$0uAU@DŽ$ЃA}@0D$L%1 H5 AG1+$Aw$ADA_ A_D$AwHAo0AL)AD$D$H|$0LT$@D\$HL$ ՞T$AOL rL$H5 DL5MDHL$(QP1R HT$ AL$RAG H5 PAGP1HD\$PHU AEL.LEH5O 1AVLT$XE1ARDH$HH$AD$HH$H D$D$HD$ l$DT$HDt$pEHL$0HHhH9~H$Dd$LHD$@@HEHHD$PIA} AO(|$HD$8HHM_PLUH9tHsI92LMMILIDHsH9Mt4LT$XHI|$ 1jE11IjjH LT$X HH9\$8uLMM׋L$Ht@T$Lt8H$H$HLfHHtHH]H9HH9uHEHXH9D$PH$D$XH$KD$HL$$t=H$H9HHHfHH9X|H9uA|$EG$A9D$@u AG(D$XAuZA<$u@fD$ $;9D$ HE HhH9D$0AUDd$L($Ń9D$ sAUD dl$ $BT5A 9H|$ AT$D9 t~9tzEH$H$1LD7HHI9t6H9uHHHL LIDJDIHI9uʄt $A teDH$HA0H;|:H1 H9~s9uAw@˅t D9MAW(9A)A96A}y $AO AOΉt$| D$1Aw$D$t6H$QHHLT$HFfD09GHH9uT$D$AODƅt AWHu4I_HD$ HD\$IG`E1\$@Lt$ HD$8D$HEqAoHI$C,)AL$HAW0H8HH\$ KH{SA;T$ DT$XT$pL$Pl$LkDL$LHE+O T$xE+OLU H5RL$`QP1sH L躗H}HHILX11 H5DŽ$bD$HD$0AFsH5FHHEL$ L PHAD$$ H5DP1A^HA_HM$$L9d$Lt$3Lt$ LDLW1ɺN H5!,@LH51E1(@H? 1QLxH5rXZLI1H5DLV1ɺfL1ɺ7 1H5Of.L1"H5f.1fAF4H|$1Ҿ<AF4AF0D$AF,AF@AFDE~0f.Lt$ L-DHLt$LU11 H5bDLt$ LDID$HL;H5H@LH8s(1XZLRM\$t@L1CH5d+D$tAF1HL$`Av$HHtHQH$L PHRL  LD1H5#LLr(Bu;LLt%H="LQEWXEuAGXHH AU1IAVLe@H511IAXAYHL11D$DI9tTfDPLt6HLRHQNH9u HIqHI9uHI9u@tt$DHl$DH5}HHD$DD$$A Dt$$AGxtE9whAwXu I`1L3H5@11Ƀ5AGxAwhHI9H\$8E1E1Ll$(AL|$EI@MNAFLA^PAn$IyHH1Dd$A܉A;^LH@IHЃ8uHxHHPBtINDDd$HIHDX8pL12HT$DD9# AAM6L9t$(/L|$H\$8E1AOhM_`AwXAT 9L$AXAOh9L$EA4ZAG4H߉L$6HLID$,H5FPD$PL$ 1Q1H HCtA4 HAG4_FHG@(Ht$HdH34%(HX[]A\A]A^A_ALJDt$\C\zHAo4BGH@@D HsPAGhHt$AGhSfDID$H@AOTL 1H5gLG1ɺ$1H5F1DA9AAI~D\$ t$D\$ t$MNDDd$IyHH@u0E11sE^8AvL uA+qZfDLE=fHOPH1DIHtI~xtLH)H9HI1MLvH5@11/H1EO|IAGhLkPA? H4JcH>fDL9F1ɺ1H5@ID$IG uf.AwTs>H AAGTIEID$H@ 4 1=D@qM`1L`H5'fAXIo`\, H9 Ht$IG`AoXH9v1HD1AOhAՅt$9wzEg|Etq)Ht$)9s\ẢL$A)%1LlwH5,@H1ATL$A1aAOhD)AOhAXAYnDL$Dd E)1rLH5@H1ATL$A1AOhD)AOhAZA[DHCXH& H'. H} |L#1H5NA4AG4HBH@@tAWHtHKXAOh@D)A9HLNIH51 fDAG8EwPEuKI(uDHTD$ LPAH5g1Y^?fDAXAG4xAPu I(AG4AOhfD\$D\$1L'|H5@E11Ƀ'D\$ID$E_T@ AD$L1At$8AIw`AGXv I` AxEohtE)H{XEEtIML$AA"u=E\$LEt1IqIyDƅDDE+Y1A1A͋D$D9cD$HDAGhHx0C\ AOh=DA9IT$B E_XA*v I`IE1E1I9u8f.E@E@@tD9uYAHI9oHPHRutt tՋH8I PL+W9A@AttI`uLP1H5KfDHHLhIH51X@HCXH'yH$HF?HHAoh,?H;kH?@HJL\H5fLp1MH5<EL|$DH\$8E)AOhfDEH\$8D)IAͅt 1ACL5AOhHжHk 0Ht$ =B9D1AD9ΉH|$0HEH|$0HD$HD$II1ML H5E@H11HT$RXZ@HjLAUIH51ջA[[fDL1H5\褻L=1ɺ'8A8*f.HXtE1HAxAuAhD⋰j&AGhAA|IWxG$HAH9IL-HALEL5>?*AUA1ATLH5\AVP1蟺EO|H %f1AAx%AAGhAGx5AA9AI}AGhHI1ALH5@H11ATA]EghA^1AAx%AAGh@1ҋAx$AAGhuDII9xLxU1AhAx‰$AAGh7I$LhIŰKDHLIH51@ALJE_xEu ALJHH96AL-}ALJL-lt L-XL5_@H9HPHLB W+JH{PAGhH|$HE1A7HsPHt$rfHXrHߋhTrHljSqAOh9HT$H:HlId1ML H5h@H11U襷AohAYAZ9l$++l$AL1H5 TEEGXI`HA>H|$0ALHD$ 1LL$LfH5@11ضMo`L1H5\褶L81ɺ8L-NL5XALJfH7HPHWHx yAHCXOIw`H|$0LJ^IH51fDHhLIH5{1@H谯IHHiH|$0HH謒HT$HAGhHH9t$9rAwh‹t$DH|$0H詒D$DA;$tLA$ID$HHXALJ 1LH5@11AOhAD+l$]La1H5d謴@L1H54|HAɺD$ LPfDHL|IH51p@fHxLIH51ѳ(@L\H5Y観H߉t$DD$ 4t$H@@DD$ E9GX3H4H>>LzIH517fE1E1111AAx0AAGh@HAɺD$ LTPHD1Lt$HI>AGhI@H8 1IL H5<@H11AUx_AGhAAXEGX!L41ɺH5=Ll$01ҾLqL4HcIw`I1M麹LH5@11ɃAGXL 41ɺ1H5n趱JHAɺD$ L]P蚩Dt$AWAVLAUIATUHSH(LH$HL$dH%(HD$1M9t2Ld$fIGLHHxH1u D$9LM?M9uMIM9t9Ld$DIFLHH@HxH1Ϥu D$9LM6M9uэKH$Ht$1HHНHIHL$dH3 %(uH([]A\A]A^A_聨ATUSHHtHtH[]A\fIH HHt L`I$HtEH[]A\L)1kH5fAUIATIUHSHHHt'LLH9HCHt@HH[]A\A]fL1}H5$lf.HH1L111H52ATUHSHHtsUIH}HhtQH_hHtH{tHpL- []A\fDLH []A\f.0HX`DHEL-1H50LHH1r[]A\ff.SDHOEHApHQpHHH9t%H;ptrHHH9tH9stdHHHH9uHFHQHL nLH5H@HRɹPH1LE1˭^1_[DHHCDEtDH@H@h[fHHHHH9;[fDHx.H@`[AWAVAUATUSHdH%(HD$1Ht/uSLl/1ɺ 1H5E1Ht$dH34%(DAH[]A\A]A^A_fLw1HIvHI~P,HQInhHtHH=ADžI^pMfpL-L9u4s@:IFPHu~HzHGhHL9tAHSHt DEEtIFPHuHHzu-HH@`L9uI~PH4$AH(f.HxHADžwL.1ɺ$1H5`訫HEH1MH5:LHHHB!pH1pYHS^=DIvHI~P1ɺ+HIFPLt^HAvH1ɺLH51A AYAZLM-1ɺ1H5HAvH1LE1H5b诪A[[貢fSHHtIHHHHHH[L1H5f.AWIAVAUATIUHLSLHMhL$ dH%(H$1,H5M'H蕞Ht!HHT$ HHHwHT$HH)IL11H5 SH{IHH{HrIFHHeD$ M~XAF`HXIFtIdžAFpAdžMt7Ao$AAoL$ANAoT$ AV Ao\$0A^0ID$@IF@LHw11LUKIEH@H@HHtLLЅHCH@@YtHHHIFhH$dH3 %(LHĸ[]A\A]A^A_La*1ɺ1H5.fD$IH?L H7H5oHDºE1P1觧ZYYL)1ɺH54聧H{LE1&DL)1ɺ1H5GfL)1ɺ H5!1E1LH5@L1)1ɺH5|ɦC@L )1ɺH5T衦觞AWAVAUATAUSHH(HGPT$HHD$'HHCPHxHD$H H|$L54zot$HD$E1E1DIdMO$HE1HDщAWAVjjjH|$8 |H0IEAW$AW HՉЅt AEL)‹9Mtz|$usDAo A)EW$ExH&IHLMO$EW$APLtIx1HwHxkDAh Ip1HCP(HxIHttHxMH|$LPXLA'1ɺoH5٤HD$HD$H([]A\A]A^A_@D$tAG AO$Lƿ1VH56~HD$HLKH1UcLH5FZYHD$fLMH5?ff.@SHC_t[DHCPHKX@HLKHLs H5m1譣XZ[fSH^u[DHCPHcXHLKHL H5 1MXZ[f1efDAWHAVHAUATUSH8HOXH|$Hljt$T$HL$(HD$&D$$D$ L|$AG[tSItILI_H\HLtH@ H5ELHHS1苢A]LA^O_HD$\$1L8DL9t$(IHHEA9^$mIFhHt@IVHL  H5¾LJHpH1I~hA[A\^IHt # zIHt DT$EIFH@ IHxIF@^tfLvIIH@@HLu+D$L#1ɺ1c tIFH@H%s4IHx< IHt# ZMMLIFH@ tHIH@A9F$t1AF$I~L1ɺRIH51ZL2E~$MFAvLIx t 1A@YE(fE1AE;fLDDLl#uL!"1ɺH5l蹟L"1ɺ\1H5P蘟E1H8D[]A\A]A^A_A+@1ADAAŅ^fDAV$D)AV$uAVPD)AVPMvD)HD$|$ t D$D$$D$H|$+t$/gH|$] Htt$ ,P$L$HL$HAPH9XHL$HxHGH@H@HHtHt$ЅbHtH HD$(tFHD$L@PIXHt1IIH90HHPHJXfApDIFHxL(HIFH@,AzEE)~$EdfHEL1VH5'tAXAYIFH@H%OH|$HPHRHуL$ tDx(1EL$ D$$2HPHJXHH9uI8qHD$H@PHXD$L1ɺ;fHL$PPP$f.D$L1ɺaH5%1kD\$1ɺ"D$LH5>D\$1ɺ%D$LmH5ĸD\$r1ɺAD$L@H5D\$EAV$D)AV$HHO'HCPHqX(HǀXD$L1ɺD1ɺ<D$LH5^D\$H HD$Ly1ɺ}DD$L]1ɺw1ɺ9D$L:H5ޚD\$?1ɺ,D$L H5d豚D\$D$L1ɺ3D$L1ɺtD$HD$H@PHXLIH519D\$ff.@1ff.@AUH5yATUSHHHGPDH8PHIEuDALD1HHH!CX耝ŅtRH[]A\A]HXŅuL1ɺ1H5 Q1L1ɺH5ߵ'H[]A\A]f.LY1ɺ1H51SUSHH<C\tF9t^HpHVu6HL +Nt H{PE1H_Ő9tHHߺ[]3HuHL I&HڦL IH5131ɺpE1LhH5 HL^1ɺIH51ۋHxݯL1ɺH|$(LhCIU蜃HL*I1L 1ɺTH5NH}H}HtH}HhH[Lf 1ɺLCHH e2\uL\I1ɺE1L H5o輊1LH5H蕊d LIH5 1f5AWAVAUIATAUSHHXdH%(HD$H1uHCXHBC[HDH%JADžRHLH?L1ɺ/IH5U1蛉HCMDLHp!ADžfDuHPH脳tPLͪDHL)ADž.AHL$HdH3 %(DHX[]A\A]A^A_fHADžuHCXH%@1H-slHXHCXH(s]EuXHKPHHH9tAHHPHrXtHPHrXHH9uf.1DHLADHUHADž:HLHolLIH51E1ŇHBHCPE11HL$ AHH8衜qDL$ EcDD$8EUHt$HADž D$P$EHAH裡HI蘡LH=H1TuDT$H(D[]A\A]A^A_DsPHmH;l$HD$HHXH@PHxHGH@H@HHtHt$ЅAH|$p sH|$D$-HID$$LH53P1}tZYDT$8H|$HH5 AVIL+1:t^E1_D$Lu1ɺLb1ɺ1H5sE1D$L51ɺfAWAVAAUATUHSHHHLfPH|$HdH%(HD$81HFHHD$(HD$ AH@ HCXuH.ADžHT$HLADžumHCX@@MEHHkHH@HhHEAHL$8dH3 %(DHH[]A\A]A^A_@D$A$L eUL#H iH5LLD1E1rZY@LKH1LiH5`rYLKH1LH50r)LItL$LU1ɺ1H5qfDH($H萧H0H@H@ H@XHtHKP1HT$H9Ѕt D$cHLܾIH51aqZ@HD$HHx臎HD$(HHT$ H5=,H腥ADžtfHD$(HHCH)EHD#HADžL*1ɺ1H5xpL1ɺ1H5OpfL9E1H5#kpdfDH*HK[hff.ATIUHSH1HH~PHdH%(H$1t HH}PH5uHhHtkH1HLÅt-H$dH3 %(uaHĐ[]A\L1ɺ1H57oDLI1ۺH5 To]gff.fbfR2fAWH1AVAUATUSH8Ht$1mLF1ɺHiIHD$MH@PHHH|$(H9H|$(HWH9T$LHH|$ L9MMDAwLE1MEMu]AD9CDL<@IIL8uHL$H9HuIyEqPEA hGE|$EtDd$ML|$MEE@II9t!S 9w C$ 9wHI9uI|$E:HLAUI1H5EmXZL1ɺ1H5"jmH81[]A\A]A^A_f9D9A)DMDd$MAqLAD9MMM?L;|$ |HD$MH@PHt$(HH>H|$(H9H8[]A\A]A^A_D$I|$ADStwC$XEMLd$D|$IJ| I~HUSILeAWH51AU6lH DLq1ɺ1H5lwfAW1AVAUATIUSHH@H|$(HL$1LD$ LAvHLJHH5i kM$I$HD$8AXAYI9D$ AWLKE1fDAE9oL2DH@IL4L8uH9Xu΋pHcHHHM@ A}L H|$HM0HH!H9IuPBT1AOP991HDLqID$PH53H8U!HEHL$ ELH|$ HD$ HxHL`H|$HAD$ E9oLfDM?L9|$(D$ tL肃vA2HLKHLPH51i^E1_H8D[]A\A]A^A_VML$HLH5XPR.sHQAG P1iH0E1IHLKHL BD0PmHLKHL#t$H5QP1#iH E1GD$ L\113H5hDT$ LȊ8H5yhE1L@H5OhE1L1ɺJH5(uhDT$ ff.AWAVAUIATIUHSHHVPHHH9t>IHsH9t MLHLADžHUPHHH9uHADžI$I9uHL9txH{HgXADžuL1ɺk1H5?gHD[]A\A]A^A_DL1ɺ`1H5OgDAL1ɺd1H5׃gff.fAVIAUIATIUHSHHH9u CHH9t8HxXt1LڈzH5ef[1]A\A]A^fHIHHLHH9t!Hp0HhH!L Hp0HH9uH I#FX[H EXHI!FXAIH]AdžA\IdžA]A^AVL1ɺAUATUHSHH(dH%(HD$ 1wHLNHH5WeAYHAZ_IHLhL9t[HsHLMH1E1H5 LfQeY^HL$dH3 %(DZH []A\A]A^LLA|$LI$8cH9hH9tAą11HHAąIEPH5%H8GHAH1HZhAąHmHH5φH|1__11AXHHbH5J`L HHE11jHHjjjjQjjjLL$hR\HPIHE111HH`_pHL9HKPHHHAH@@Yu2L%Ml$(LLVIM9uEDHHHHCh뷐L1ɺNH5 {11M^La11H5z^DHCHHT$ H5HHD$ HEHHD$(JL+1ɺo1H5yz]t@L$1H5Lz]GL1ɺ[1H5zg]fL1ɺQ1H5y?]f.Ly1ɺWDHCPHML&1H5y1\XZHCP3LLH5ey11\\HCP8LLHCPHMLAijTf.AWAVAUATUSHH8T$L$dH%(HD$(1FY IH~H8>Mt$`Il$`D|$L9uXM6AI9tEDHIHAv@P9sAu HWAEPM6AI9uHCPH .~ HH8H[HHH@HD$HpHHCPHxxL1ɺIHGH!N1LAD1HD$LCPHPXHD$ H*DD$Ht$ HߺuHCPH5[H8jHD$H Ml$`I96t$H|$HD$H HD$HA E1H$P jjjjjQjjjHt$pH|$hzWHPIHJAD$E1ufAE9t$qDDLHLHHPYuщD$L61ɺH5v1YDT$,DL1dH5TvYE1HL$(dH3 %(D3H8[]A\A]A^A_Hs^LOIH5u1AYE1@HsHLAWIpH5u1YZE1Y`fH߉D$dsHH5uID$ LѥyP1X^_DT$HD$ LHܲHD$MmPPHD$ T$I9HCPHKXHxHGH@H@HHt HЅAD$Lm1ɺ2HrLhIL91ɺH5t1WE1.L1ɺH5[tWE1L1ɺH54tWE1HqHLAID$ P9ZOD$L1ɺTAWAVIAUIATMUSLHhH|$PHHt$HL$@K HD$H H{L}1H5sP1AvHMMHVIuHI~PAXAYIH HHD$0sHD$LHHD$(L|$XL9Ll$8Ld$HIALE1MEuAE;wLDL$@IIL8uH@IPHpHz@H9~@uIP HH9tDt$ MMHI;^ IJD(D`AGPkATCŃ9rA9wIwFtAOLA9r~9vH|$D)Aw -uL1ɺH5 rZUL1ɺ#1H5q9U1Hh[]A\A]A^A_D)H|$T$AG $賬 $T$VL=1ɺH5qTvMDt$ AE;wLf.MM?L9|$(>L|$XLLl$8Ld$HLt$Ht$0IFPHH$迮IMD$HD$HL;|$XZH$LAOL1Iu3A9_L#H $HH@IHЃ8uH@HPHz@HQH;z@uPHA H(H9tMDuAA9A9AOPT$0L$([jmHD$ H$H@Hx@BjHLRL$0I1QT$@RHt$8VH5 pAVUTSH0t$uxMtsI$I9t,H|$HT$H;xuDH9PHL9uHD$PHxmHH|$HHxL.D$fDH@IHЋHBH5SHhDpIEPH8B H1HD$8IGHHpHH@PHAGPHt$0ATHL$(T$ 2Ht$0LtI1VHL$0H5nQT$01RAVRAOPHE1AAWLjjjjQjjjL$L$L OHPHH1LHn6H|$HHIUPAGPE1AM LHILQ>L1ɺH5nOQAG AW$HL<H5mRHPHD$ pHMMH1QH 1Hh[]A\A]A^A_f.HmH9MDuAAD9w9 fDL 1ɺ1H5WmPKf.D$L1ɺH5maP @L1ɺ1H5l7PfLy1ɺ1H5lPf.LM?L;|$XDHP1ɺPLt$1H5llLWAvHMMHOIuHI~PXZ;HuL1ɺ7HHD$0VHD$HHD$X1L 9H5k=O1fDAWAVAUATUSHH $HHD$$D$dH%(H$81H$HD$$D$D D HyADžHCPH8"EHCP1ҾJH8H߅bhL1ɺIH5xj1MfH(hLԠaIH5;j1MH$8dH3 %(DHH[]A\A]A^A_DHgLhIH5i1!MHgL IH5i1Lc@[gL<1ɺIH5qi1LHL(gHHCPLMI H8ijL&1UIH5"i1hL_AX谡1fD1LLTLAfHsX+ADLKHuLH5h1E1KWEHL$Hl$HHBH9ILFfIHCPLH8hUL1ATIH5h1MI VKY^蟠@HD$ HD$(M1Hl$ DHT$ HD$(HHT$ L9HL9v LH)HD$(A~T1H_:t&B8cv?1L mLPHmPH5:g1JXZ螥LHLd$(Hl$ dHܤL mHLmLLDHATUSH5f1E1JH LL$zLڝDHhdL1ɺIH5~f1IHCPj1ɋ$ALH8RD$HT$(OA[]ADžq裤LHcHL )lH>lLDHLwl1SH5e.IAYAZD;HCPLH8eHIcHyL lHkLLDHATUS@fUHAWAVAAUATISHHdH%(HE1qI$AI9uzHL9t`HH{ADžuL1H5d1HHUdH3%(DuHe[A\A]A^A_]@HCH@PHHEDtEDHHHHHHH)HH9tHH$H9u%~H\$M4$HH]M9rIE1M6AM9tWI~A_}HMDuIvHEL nXH8VADžPIFM6AHH!HXM9uM,$M9uMmM9fI}j)EjEuu)EH ADžuL 1ɺ1H5YcFHEM,$H8M9tQE1 @MmM9t?D9vHuDEv<uIu@HEMmH8M9u3LT1ɺ#H5bFL 1H5bAEfHt#HCtHL1ɺ1H5?bE1ENA<DI}E1_LEKIH5a15EHEH8A}H)HLtHEAH8IyE@HEI~R_LIH5ea1DDT$Ld$@D$LCLH4@HCHH@PHx&YDT$HHKLE1tV9AHD1HP=A0AzDAL$0AL$$)Ήt$(f.HHHD$8LHEH\IL KXHD$HLKXHD$ HE111jHHjAUjjjD$AUjD$\P5H$HPH'EHD$`Ld$@E1Dt$LIDt$HD|$HL|$0LD$1E龀H\Lr%K`LCP1LHLD$ 1HDLf8HEt AE9HKHAoLD$1LH[$rL1ɺt1H5CTLd$@7HQL IH5T1W7fAT$j1LjDL$$IHRg^_AŅLn1ɺ1H5S7DDDL$(H΋HHVHA;DL$(H%HDL$( H{PDL$(DELٸ1ɺ1H5'So6*f.L|NH5R>6LKHLZH5R1E16fDLQ1ɺ1H5RE15Ht$H苌1ɺE1LH5TR5\@H{PLKXHWHD$ HD$ILKX}HKH1EHYLc"K`LCP1LH1HDLIR5L31ɺH5~QLd$@4Ld$@Dt$LD|$HHt$0H|$8hLٶ1ɺ{H5$QLd$@l4)L1ɺ~H5PLd$@<4L1ɺp1H5PLd$@4HCPHL$\E11HH8UHAŅCZu|$\LNL%1ɺIH5bP13΅HKXQLڵ1ɺ[1H5(Pp3-HMLdIH5O1<3L1ɺH5OLd$@3LW1ɺ1H5OLd$@2]^ML IH5qO12r-ML4Ik*ff.@AWIAVAUATUSHH(HoPD^ HT$H|$L ADž A$tEH|$+ADžH8HD$@\ A|$4=DHA@H|1I0H5BL@11%At$Pt A|$4;EHD$H@PH8A Ht$H|$ 芏H|$@@LJIH5+B1E1n%KfzLVHHT$?HT$HHHLفSIaH5A1 %_AXDL 6@Hh?LOIH5{A1$}@AD$h$A|IE1AD$hfDL1ҾL1ҾAAA1YEL~1ɺH5@1A2($4La1kH5@#E|$hsfD[DHY H;>L~IH5N@1#Lݥ1ɺ\1HT$PHRHѤHyHt$P~=^ ȺC)D9AOi@B98 i'DdD9ALǍPE‰$FH>D$LN<"fLI|1RH5d?"IVHRBX y1H5)?L@11b"At$PAD$XID$`EL$TE IFH@@Xx1LH5>@11!AD$TfDL)1ɺH5t>!@L1ɺH5L>!@MHH9D$t,x1L H5 >@11M!ED$PEu A|$4LkPL|$PfE11ALHI})D$P)D$`D$p6A|$PD$P AD$LA|$4AT$hUAL$@ED$DE1H޿uADž+LD1H5.=v SL1ɺ1H5=P IH$DŽ$IHXDA|$4LQ1ɺ1H5<fC[ v At$hAI}HELח1ɺ"H5"2oHADžL1ɺ'1H511QH/L(u`IH511HHCXH<H|$M/LuIH5`11L1ɺH551LL$(LuE1H5 1S0I>0It$`I>HD$00HD$(j1L!rH50@H11HT$8RLL$8>AZYID$`HL s1H5l0pI>@20Lnq6IH5501{L1ɺ41H5 0UuLL$(L71H5/'H|$0M# USH8dH%(HD$(1HH|$ H$mHt$H'mH HT$(dH3%(uH8[] SHGXHu@HWPHuH*HCX[DH$sHxXHCXu tH*HCX[Ð1G]tTtLuHHHGP1ɺ~LtH5.LwH1H1DAWAVIAUATUHSHHLLdH%(H$1HH$HtHT$1LLtIoX+AF(tIoX,IHP IGXH-H$5HD$Ht @\8LHbAV4H<$LͶDL$EAVDLL҃ IH@H* T H|$t AG] M A2H<$Lp2IGPH8FrAM AuIgXH|$pH|$EFx1LOAHHAV4Ht$H<$蚵nH|$ Lt"IH1DLhH5"XZ@AHEN|I`vLLhH5"cfDL$H|$ HD$ Lf@[\H|$j AVxAH; H<$H5#L1ɺ IHSHL$IF/H<$LD 1@ƃAv4LX LwdIdLa, fL(L~1ɺ-!DLL1ɺ"IH51TIFD$HLHD$@HD$LIHD$TAFDD$\t$Xt$Xt$Xt$XˬH A>H L L!/"H5tLD1IGPH8(H<$LteL"L{jILqe1ɺ!1H5GfH*]EEH;H5ƱL_}1ɺ IH2HL$AFfD1ɺs!E1L}H5qfH|$Ht$LHH AMHMEEvxL${L$MMDDH5gHIVx1Lsg^"H5 Hu{HHL`b{HLS{HWgLHؓLa H|$Ld$`IwHHL` H<$L1LI0L{1ɺu"H5I@MPILI HQAG]VH<$LbBLnLe="I|LN(H1LZ^E AQH5U_AXf.HQ L^IEEQH*H,H<$LIGX\aIwX,fL1yALP@tyAPDDL1ɺ!1H5f.L L[HLy1ɺ !1H57f.'H<$Lr` LLa!IH511ɺ E1LJyH55HMNX L]E1H5iXZLLx1ɺf @Lx1ɺR!H5iHK L)\MN`k L\IQLL_R LLHHaL5x1ɺM"1H51ɺ E1LxH5WLL[d"IH5*1pL\ =AV4H<$L赤LLT!"IH51WH,H<$LIGX^L/a"H5YL*Ņu1H<$L]L_*D$Il$LLv1ɺ!H5 VH *Ht$H<$_aHt$H<$m``1LLLv1ɺ!1H5mD1ɺY"E1LvH5iL)q LPZI5H<$Ld]A^XL !LARLXH5 P1A[LA\inHLHSnǀdLLLX!IZH|$+LD\!IH5@ 1E1LZH5 _1ɺb!E1LnH58@1LEZH5LUn1ɺOH5xL1n1ɺKH5|T@AUATIUSHHV.LIEH HnXH}H?H5aHHHHS`HL]HHH@^HA1Iٺ"LL[H5@11H)H?H5cvHHH]HS`KDHLH$HHDHHVcDHEHLHC`HSPHLHHL`HC(u=@1M#LH5@11HH[]A\A]M1LZ1ɺ#H5HH[]A\A]fDH?H5\yHHHKDHS`HLHHLk1ɺ"1H5.vSLk1ɺ#1H5O,f."LBYIH511DMM(#LcYLX1"H5Lk1ɺ"1H5_Lj1ɺ"1H59^Lj1ɺ"1H5[8Lj1ɺ#1H55Lyj1ɺ #1H5f.AUATUHSHHPtdHrH{DI@HLPYIAUH/dATH5dP1EH PUd CDt;C@rsH[]A\A];rH{IATIHfPLX1H5cEPUZYd%HqH{Dc@I`HLpXIAUHXATH55cP1H EH[]A\A]fDHGX@u{ uvAUATIUSHujI$IİH]L9upHLL+I9tbHtHEH;CuH@ H@0HtHHЅtHH@DfHtH@H@X@u vH[]A\A]AWAVIAUAATUSHHHdH%(HD$81HD$4HD$H9Y"D$E1IAM9t$tEHMNHs1AWLFWH5a=T$DBD$D_AXdAD$ ;D$tLHMNHzL7WPD$H5zaP1AWT$TBD$TH drAL$$At$PIT$9t\AD$L+B9tMHMNH1VLWH5aQAW}T$TBD$TH dIT$BtID$pHt I;D$XEDE\$LE1@I$H@HHhHxHtIvPH9wPu I9cUMNHL?[1AWH5A`T$DBD$D_AXdDI$HHxEtwHtrGZpdHt H L9tAUMNHAWH5_1LZ8T$DBD$DY^dI$H|HHH91@1L9`HH9u$@Et+ID$H@tuI$;HA9l$Lj\$A\$$\$M$$L;d$At$98II1HD$H9tLeID$AT$LLH3BMM1Ht@I 1I$HAA9@I$HtEtMuL9tfDHH9<uL9tufUMNHAWLX1H5^uT$DBD$DAYAZdH\$8dH3%(7HH[]A\A]A^A_fHt L9g UMNHAWLAX|@HGHMNHLXH5d]AQPP1AWT$TBD$TH dTLOHLXAWAvHH|qfDE]f9o(FfHCAT$P9HMNHLzXRH5\P1UT$TBD$TH dbDAFZID$@ iAF^I$HH HPX IVXH0O@^EID$H:u7A$H A$LzI$PIFPAt$TH8CR ID$@_UA$HI\$Hku AF^I$@HGZukLiI|$H;HLQIHV\SPH5[1AWD$TPT$TH d1I$_H'HL9I\$HkyA$QIL$H5[T$ HyHHL$HL$T$ HB.LhI|$HQHLPIH[SPAW1H5)ZD$TPT$TH dGI\$HkA$`I$IVXH1H-A$HA$LWI$PtcLgI|$HHLOIHxZSPH5_Y1AWD$TPT$TH dyI$XtcLgI|$HHLuOIHZSPH5X1AW_D$TPT$TH d ID$@_+LgI|$HHLOIHSYSPAW1H5{XD$TPT$TH dLHtH@@LfI|$H HiLNIH6XSPH5W1AWjD$TPT$TH depHMNH1AWH5WLM T$DBD$DY^dDLeI|$HkHmLMIHWSPH5GW1AWD$TPT$TH d\LpeI|$HHLcMIHjWSuPAW1H5VMD$TPT$TH dLeI|$HHLLIHMSPH5wV1AWD$TPT$TH dHt AF\HIFXuHID$HPX$ HA|$LuyI$8ulHxZHtHLD$TPT$TH d\1I$ ID$H@H)s3AF[  "I$H@H!@[@ ID$H@0uwI$tlLZI|$HHILAIH$QSPH5uK1AWD$TPT$TH dID$H@Hu tA|$Lt u AT$Td%uI$%HDI$5LIYI|$HHLL7WI|$HHL*?IHSPH5H1AWD$TPT$TH d~1M9$M9$M9$M9$h1M9$AtM9t$XM9$IL$YE9t_HAt$ LJDRAT$$RVqHMNHP1H5G0T$dBD$dH0dIL$HHH9uuHH9fI9u1M9$HmH;l$MIL9udA IH9GhtDMNH-LCAQwH1H5FvT$DBD$D_AXdM$$I9ID$DHxEuKHt IH9p`tID$MNHLC5H@AQpHyCLTI|$HD$(cHT$(H5[FIHx>L9;R0P1D$DPT$D^_dVI$HDAT$ AD$$HLDLIHAvHH5EпP1RET$TBD$TH dFHQHAD$$HLAAL$ MNHAQRPQR [LSI|$HDHL;IH<UPH5 E1AWD$TPT$TH d#5LISI|$HHL<;IH;SPH5D1AW&D$TPT$TH dI\$HkLRI|$HkHL:IH <SPAWLRI|$H.HL:IHDUPH5 D1AWxD$TPT$TH dE$EMI$tcLRI|$HHL :IHHSPH5C1AWD$TPT$TH dI|$htcLQI|$H?HL9IHGSPH5C1AWD$TPT$TH d5I|$`7L=QI|$HHL09IHYGSPAW1H5BD$TPT$TH dLPI|$HhHL8IHFSPH5DB1AWD$TPT$TH dPYLmPI|$HHL`8IHFSPAWOL0PI|$HHL#8IH);SPH5A1AW D$TPT$TH dJLOI|$H[HL7IH:SPH57A1AWD$TPT$TH dQIFXL\OI|$HHLO7IHASPH5@1AW9D$TPT$TH dH;LNI|$HxHL6IH7SPAW"LNI|$H;HL6IHqASPAWLkNI|$HHL^6IHCSPH5?1AWHD$TPT$TH dMDEtEAWLOHjH5?1Lx;T$DBD$DY^dE1MNH1L-EH5@?T$4BD$4dC1TD$DA[[hLMI|$A$HHL3IH3@USH5>P1D$TPT$TH dZ@ LLIT$HL6LJHP#AD$LPj@1H5>D$TPT$TH dE"InXAtkH0r$H-rH ruH%rH$s@MNHE1L;H5= T$4BD$4dInXH@@HH'sMfHH5L襵HbH/sInHH5+CH肵HAtI9t:MNH_1L5;H5<dT$4BD$4dAFYD$4I$Lt$Dl$ HYAL$LLD$1qLJI|$HsS@IHs>PLI11H5L<ÿD$DPT$D[Zd/A;l$LI$HRHH؋t׃sHH@HpXBt$'9tL%JI|$HD$ I$HDHL0HT$(IH=H5|;RISP1D$TPT$TH d$N@ID$H@ |i @uHHu  uI$AD$8PtcL6II|$A\$8HHL/IH<USH5:P1D$TPT$TH dzHt$4LAT$Hv$ID$@_ H@PID$AT$LH@@ODHHuE\$L1EungLHHI|$HSIH==L.P1H59+D$DPT$D[ZdA;l$LH@HI$H؃8tnLGI|$HD$RHT$L9.IH<RH5.9P1蝼D$DPT$D_AXdI$HHxGYtHID$HpXID$H@1&I$HH؃8HIT$HZXHxLwLFI|$H_SIH;L;-PwXLFI|$HD$HT$H5 8IH_;L,RP1dD$DPT$DY^dfA$\A$`A$A $ A $$A $(A $,A $0A $4A $8A $<A $@A $DA $HA $LA $P)LEI|$HHLu-IH`<S9PAW1H56_D$TPT$TH dI\$Lt$Dl$ HkD$tLDI|$HD$ HT$ Lv+IH.H5l6REP1չD$DPT$DAZA[d?I$HDHLDIT$HL-LJHPAD$LPj@LODI|$HSIH8PL*1H554D$DPT$DZYdAD$8LCI|$A\$LHrL*IPHF8USPH5R51¸D$TH 3 (A|$<LlCI|$A\$LBI|$A\$LHyL)IPHf7UH5V4SP1ɷD$TPT$TH d+LBI|$A\$HHL+)IPHUSP1H53bD$TPT$TH dLBI|$A\$HHL(IPHmUSP@LAI|$HsH*L)IH8SPH5O31AW轶D$TPT$TH ddLxAI|$H H(Lk)IH8SPH521AWUD$TPT$TH d nI$uYL@I|$HSuIH4H5j2PLS'1ԵD$DPT$D^_d=AD$8#PtgL@I|$A\$8HHyL 'IH:4USH51P1[D$TPT$TH dA$;AD$<E\$@EQED$DEID$@_ uA|$HvbL?I|$A\$HH]Ll&IHQUH5:1SP1譴D$TPT$TH dID$H8HPXLU?I|$HSIHPL%1H50:D$DXZL?I|$A\$DHL%IH 3VUH5q0SP1D$TPT$TH dFL>I|$A\$@H-L>%IH2WUH5 0SP1}D$TPT$TH dML8>I|$A\$:I|$HSIH-PL 1H5+#D$DPT$D[]dL9I|$HkHL!IH`0S%PAWQL9I|$H.HL!IH|%SBPAW1H5+xD$TPT$TH dL39I|$HSIHI,LPH5*1I\$D$D_AXHk}L8I|$HkH L IH1$SPH5G*1AW赭D$TPT$TH d<\Lp8I|$HHLc IHw/S@PAWL38I|$HH>L& IH!/SPH5)1AWD$TPT$TH dL7I|$H^HLIH-SPH5:)1AW訬D$TPT$TH d|OLc7I|$HHLVIH9-SPH5(1AW@D$TPT$TH dH@HxX|L6I|$HL#IH]-WSPAWL6I|$HGHLIH!SPAW1H5(葫D$TPT$TH d8LL6I|$HHL?IH ,SPAWL6I|$HHLIH!SPAWL5I|$HhH LIHf!SPH5D'1AW貪D$TPT$TH d^ID$hHPXDMNH1Lo%dH5&fD$4ML$TH5&7T$4BD$4dL+HtHHtxLt\MNHN1L#H5d&֩T$4BD$4deInXIL7$XZH8uL9pu虡fPMNH1VL!H5%VT$DBD$DAZA[dL4I|$HURIHC+SPL1H5~%AWD$TPT$TH dID$H@0L3I|$H8HXLIH*SPH5%1AW肨D$TPT$TH d.ID$H@ff.AWAVIAUAATUSHc)HH'h D9HxGLH0D@(HH$HpPPCTPPCPPCLPC8PHPIHHIFPHHx{DHSsL)B7A)D$PD)E1CPAl$$K$K AL$ DHM$H,@HHIAutKPJE1DHRL^I$HMNHL"D(PHHD(pHAUAWC PH56#1覦H0AD;{LCHL)I~PeÅFH[]A\A]A^A_E1L"H5"9L(1ɺ1H5"1@HBsPELLL$PHx)p<LL$IAHI$HD(PHHD(T$H@Hx@^HMNHL!T$RPAUAWC PfInHHT0|L!UIH5!1AUJXZ 1Ly'1ɺ1H5!f.HAvHEH5m!LJ 1ѤY^Yf.L 1H5*!蜤^L| H5 n0L&1ɺH5 J L&1ɺH5 &Ht G[tDuuATLgpUHSH_pL9thHCt.Hxu!HL9u[]A\Ð[]A\f.1ff.AWAVAUIATIUHSHHHt/HxXHXpHt HՅHtLHՅMMM9#IHt LՅIHt LՅIHt LՅ\IHt LՅqIhHt LՅIHt LՅAGL1ۅuuDA9_LvgH@IHЃ8uHxLՅuԉD$ Li$1ɺsH5$1DL$ HD[]A\A]A^A_M?M9LZtmIIŘL9u XHL9tMH{LՅuD$ L#1ɺzrL#1ɺa1H5#cE1aAVD$ L#1ɺj'D$ L~#1ɺhD$ Lg#1ɺlD$ LP#1ɺfD$ L9#1ɺnD$ L"#1ɺpfDAULATIUSHHdH%(HD$1D$L9t]@UL1ۅuED9]Lv8H@HHЃ8uH@Hx$tIL$X9]LwHmL9uHT$H5LÅt5D$uHL$dH3 %(u9H[]A\A]IL$XL!"1ɺ1H5I"跟ATIUSH HWXdH%(HD$1tHL$dH3 %(uYH []A\HHH4$HHWXH5HLd$tLHHSXHHHSX&fDAW AVAUAATIUHHw SHLwPH} I9t9HAML$HH5H!1E1L$_蠞^_M$I$HD$L9AGL1ۅuA9_LH@IHЃ8uH@H} L`LD I9tMLHmAUI1L9$H5 E1ZYA9_LwDM?L;|$RHD[]A\A]A^A_AWE1AVAAUATIU1SH蟐IDI9vl@AHHPuyC<4vbHE1ATH5E1AL#>L6Y^IŐDI9wHD[]A\A]A^A_fDH Hs:u[@tUHE1ATL#E1AH5I輜L贏IXZzf.:DA\ff.AWAAVA)AAUIATUSHHT$ H $dH%(HD$81ID IHLH\$蛷 LB#fAoE9H<$‰ItDDDI H߾ 1H& ؈ Hڋ H!%tHADHJHDщ@LHH)g ?L"H5-LLE1迵 H\$8dH3%(LHH[]A\A]A^A_fH5UL L輷 Lp" PH5;1AVDL$蠚XZzfL%1H5:@LQ!1H5D L!4@UHSH HHt-Hh@H5 H) HH[]L!1H5F贙fHtHVH61DSHGXu[H%HH5HGXÅuL1ɺ1H50ff.AWAVAUIATIUHSHH0 D$ MIAL9tA M?I9t=ILH u1ɺE1LH5 蓘M?I9uIH9tH}1HmH9uD$ uLHD[]A\A]A^A_f.I}1e AƅtQMIAL96I}1E u1ɺE1L;H5lߗL&1ɺ1H5N輗[ATIHUSHɜt5A$Lx2L31ɺ1H51_[]A\1LG1ɺH5/[]A\UHSHHHHגHܺH<H)1 tH[]1L1H5A诖H1҉[]@H= tA=t5=t)A1ɿLH51KHff.@ATUSHHHHHG`1Ҿ*HxwUL~HH5eHH HHD11HI跕 AI9H{@Ht8HC`1Ҿ)HxYHC`1Ҿ+HxYuvH{@ H1PL1L!H50XZ[]A\fIL11H5HHC`Hs@H@H踣Hs@IHtTH1IHtGHgI1PL1ATH5L荔LHs@_AXHC`H@HdH{@IHH1IH1ɿIPH5L1ATYLH{@^DAL11H5nLٓL*DHC`Hs@H@HRIH&H1IHH{@:I1ɺPLh1ATH5L`AYAZLSHH@Hu&Hu]HtHC`1Ҿ-HxAʉoAŅtN葠I<$H胡AU~1SIL1H5XZHD[]A\A]@CI<$H5HH5MSIL1{詅Y^DH[]A\A]fA$6M$LE1pH5STfDHH9tHL$ !L$ LE1hH5f.u]H1HHtNH)H?HSHK1Iٺ\H50LѾ@11葄A$I<$HH[]A\A]E1L4E1uH5FHD[]A\A]X1ALH5 @ATIUHSHH9t6fDHCH@hHt HH9HGHL9uHt H[]A\Ð1[H]A\fDSHH1HGHHLJ(HH)8HC HCHCHC HC(HC0HC8CHHC@HHCXHCPHǃHǃHǃHǃ H H H H H H H[ @SHH?H)Ht6HHH9t#HJH;A@uDHJH9A@t HH9u1H[HH9tH;pu @H9pt HH9u1fDHHH9tH;pu H9ptHH9u1fATUHSHH9t%IHH9tH{LltH[]A\1H[]A\fDATI/UHLSuHHHPLEHH9u-DHH9t HCLHxH(yuH[]A\@1H[]A\ff.HHVH3GhH3WpH upHFHVH3GxH3H uXHHH9tEH LLVHH9t0HBLH(L@ M1M1M uLFLNL3@0L3H8M u1DHHtH@HDAVIAUI/ATL(HULDLSsI$HPHLEI9u?HL9t0HkLHEHxHwuMtI[H]A\A]A^@1Mt[H]IA\A]A^ff.ATIUHSHHtLH Ht[]A\f.11LHH1HtHtf.HHH9t#HBH;p@uDHBH9p@t HH9u1fHHǰH9tfP 9wP$9w HH9u1HHǰH9HDÐSHHdH%(HD$1D$HtbHtPLuHT$dH3%(uiH[H8uH@Ht$H@Hx@/D$9sf.1Lj $H5N}1uHHǰH9HDÐATIUSHH_ HG H9t0@HCH@@HtHLЉŅt%I|$HHG H9uԽ[]A\1Lw 1ɺH5}[]A\AWHAVAUATIUSHH( 8AE$A9E$EA$uHCIT$H@H9BI$I$HL$HD$H9 HLHD$HD$H@HhHHD$I9I M?M9IGHHpH4tuI/E1H5{L A${Y^H(D[]A\A]A^A_fDA$A9L A$H51w{_AXfHD$HHD$H;D$I$M$I9uafDHmL9NH}HtH}HHL IS:DHL P H5M1A$zH 1E1LLK H5rzDHM$L  1H52zXZSL@HA5AD9lE$A$LR SHHH9uPHmH9t?H}LtH}I$vHL ISC3Aff.fSt+HHH9t@HPHHbXH9u1H5cÅt[1LO 1ɺH5yx[UHSHHdH%(HD$1pD$tbHt:HLKH>L D$ H5 P1|xD$EXZHD$dH3%(H[]HGPHxs twHCP1Hx` HT$H5Hd1HzHCP1Hx; AL< 1ɺ1H5dwDHHT$H5I1HDL 1ɺH5woATLUHSHL9u CHL9t;HCtHPHH}HH HL)HCHL9uH}H4zH}HEHH_ HG H9t[L%4 fH}HHG H9t@HCH@8HtHHЅuM1ɺx H5)1v[]A\ff.ATLU1SHL9tH{HL9u[]A\fUHSHtjL lHtLL11ۺ_H5uL1aH5_uH[]@H{uH[]@HLiLP1H5puXZff.H1HtH=;fDAWAVAUATUSHdH%(HD$1Hu2AHT$dH3%(DH[]A\A]A^A_fDHHauHHAH9tIHH9tH{uHCLHx@s!tH{fL4$IL9vH{E1.AW1AVI1LH5&tXZ-lff.fAWAVAUATIUSHHL2I9HHL$IHE1DILLM9t@IHBH@pHtJH}HЅuI}Dt@HLu ILM9uHD[]A\A]A^A_AH|$HS vfDE1AWAVAUIATIULSHHjH^HE0Ls H0L} HLHD$LHHL$LHHLA t H uIYtAHD[]A\A]A^A_DL tH|$ tff.USHHHv`HFH@8HHt'HHЉŅtJHH[]fH{ptSuIHs`HHHFH@8ЉŅu1L6 1ɺ7H5`qH[]DH1L2IH5#1qH[]fDLA1%H5\q,AWAVAUATIUSH~I$8M$8L9A(DI<$1HJHmL9H]HuM$HH1ɺAWI1LH5-pID$HH@H@HHHCpY^HHHiYHE16LaIH51/pHmL9=fL8I<$?I$I<$^I$EIٹ1LH5PoHD[]A\A]A^A_@M$HxHLAVI1H5E1hoXZoLxI<$I$I<$I$fD1IٺLH5A@11n0fDL1 1ɺH5VnI$EfDM$Aƹ1LH5nL 1ɺH5]nI$(AUATIUSHHƨHHG`LnH{@H@HHFF,HFt)1HL|ŅtVH[]A\A]@H߉LGIH531mH[]A\A]fHhHNLAUI1H5[mXZH[]A\A]ff.1Ht1?#ff.Hwu DH1jLIH5rl1HfHHt :u.H1Ht >tH=ATUHSHE1uuLD[]A\@EauL1LcH5Alt@H8qu1A LLfH5bkD[]A\DHH?A@FNf.HHfDH>HHUHSHHHfctZ1ҾHc6Ht8HX Hu(-uH{?t H*ctH[HtuH1[]DH[]@1Df.AUIATIH=USHK HtVPHHv HHtfH{ HhAELcC H{0 HH[]A\A]fL 1ɺ1H51jL1H5iH\ f.HGhH9t3USHHtHHHtHPHHRRhH]hH[]Ðff.@UHSHHH H}HsHH[]sAWILAVIAUATUHH5SHӺ:HpLgL$1dH%(HD$`1HGHD$1hAX(AYLɆ HH{pIdADž|$ ]H $HC`H;At_Hp8IL1SH51E1nhY^HT$XdH3%(DHh[]A\A]A^A_fDLH%ADž IL[ HCpHAoFhLHCxAoNxAHH$ǃHxHGPKHL0HgLd$@HLJHIATL1H5]gXZfDHILL@@HIALZx@I=LH5e1E1f]fHIspLC0L 1ɺI1H5E1|f ILtH5KffDHLHAt A;tHLY:AHкH9I]LLDAAH$H@H@PHHH9t$H;_uH9_H?H9uAILa_H5KefDL 1ɺ{1H5eD$HIjLH5wP1AdH k貿 A[1ɺE1L H52d4PIL%A\f.AW LAVAUATUHH5SHHHLdH%(HD$81D$,dHLLA1M9tbHD$0L|$4HD$IED$4D$0Hx@Ht+Ht$LtD$4tED9MmM9u1LHL9EHL$4Lt$,HL$HL$0HL$D$HLIH}LH'H5AUI1L} cHEAYLAZHHx@<HEHT$D$4Ht$D$0Hx@ EtPD$4D9tGtCH@u |$HLE1P81H5cb_AXLmL41LHHHmL9LHHH% AHL$8dH3 %(DmHH[]A\A]A^A_fH}L1ɺ4IH5G1aNfDH}D${L,IH51taD\$[f.H}HD$,HBLSI1H5 aXZD\$@LY 1ɺ1H5`E1MmAM9A9HE;PH50L!1`YE1^|XfDAWAVAUATUSHH8Lg`Ht$(ID$PH@HHD$ ,k Lk(IHDs0HD$HCHD$HCHD$M$HCXHoAoHAOI@I 4HD$IHHT$ŶHT$H9/HD$HD$I9H|$ (} HgLxI|$PHID$PHLAID$HLMg`IGpID$PE1tH8jfDL 1ɺ+H5PILH5cPVfDL 1ɺ 1H57P*fLH5PfLI 1ɺ+H5nOGSH@HtYHH։H a?荸tH{@H5a?[إ L 1ɺH5qO1[DL 1ɺ1H5GODAWHAVAUATUSHH t4HHHtqIHDILE4IHt HtH9tH[]A\A]A^A_@HH P?DL裷ÅtI~@H5P?LJ H肩 L 1ɺ81H5Nff.fATIUHHSh HHt`oEoMHoU P o]0X0HE@HC@HEH@HHtHuHtLHCHtAH9 H[]A\ÐL1KH5^Mf.HL1Sh 븐HGHHtHVHH9u HtD1ff.fHGHHt f.1ff.fG DAVAUATUSHH dH%(HD$1HGHH,$Hx H Hl$L/IH9u$%DHKIUMLHA I9tItLH貧 H4$L&H9uHCIH H腧 I$LI9uHKHi HA H9E1E1,@AEuHAHKHmHA H9tXE uHEH@0HtHHHЅu1LU 2 H5|KHKHmHA H9ufDH;Eu01H\$dH3%(H []A\A]A^HHHǃHH9tHPHH!H9uH{@NHCHHCHHC@C,C,tbHhLhL5 L9t<@Le蟡1M\ MH5@11JHmL9uL c,f.H;BHi =f.AVEAUIATIUHSHH=HS0H{ LHE跤 Ht?H{@HH ]l?DL"Ņt,H{@LH5>l?虠 ŅtC[]A\A]A^1LW 1ɺH5I[]A\A]A^@L1H5NIf.11L 1ɺH5I[]A\A]A^fAWAVAUATUSHHH9IIHt$I14ALL1LALLLLHH;\$tLI|$HIHu1LN 1ɺH5xHH1[]A\A]A^A_DH[]A\A]A^A_ff.AUATUSHHLoTK HCE1HPXHt LIHCHPPH>HtLATL PHL LDH51HXZH[]A\A]utc off.@AWAAVAUATIUSHt$ ~OL4OEuH[]A\A]A^A_fDLAƉOAWL)PM$ 1AVH5UWGI$I|$H DHG蹪IH@ID$Lh0HH0M}LI9urfID$ILMHP0I9tYILtڃ؉A4t1LID$HHx 赡 l$ u@Hh H H9t[AID$HmH H9t>H.tD؉At1Hl$ uHA$11DL$LH5FXZI|$L` >L6 1ɺ1H5^1EDATUHS u(H]AH9u fDHH9tHHtAD[]A\fDAUATUSHH8HIąHAA9HyH H1H5MP1LDYH^tIHH[]A\A]Ð;+HtwHfDL 1ɺH5yDH1[]A\A]@ML1H5ADH1[]A\A]@MLf.H$L+HKHALH߉ATL1UIH5I1CHXZbKHTLMLH5cC1ff.AVAUIATIUS^ I$L5nI9u(Qf.LL_ t\HL9t+HkH5HLH^ t6L9#uLL9uպH5uL^ td[L]A\A]A^_ La1H5|B[1]A\A]A^ùLaH5OBLa1H5)BHtgSHGPHHx@HHt HHt[@Hh\HL8SI1H5NAXHZ[D1ff.fHHtdH=HָtFH=Ht+H=Hf.1ff.fHHt HgHf.1ff.fAWIAVAUATUSHHdH%(H$1H3fAPHD$)D$0)D$@)D$PAGf ' Aw HD$PHIMI9uU@HL9tIH{菢uHsM1LOH5?HXZL9uIML9HD$`E1H$@AME9PLsIL9tKHHtHH1RLH5d?MLs]1XI~pLi7H|$P L? Ht[H{H4$@HH{IUL1PLL$ H5g1>AZA[HsLHI9unfDHsM6HI9tUI~uH{IncHLUI H511U>AXAYH|$PH 膓 #HL9ZL*;IMI9t`I@ HL9tIHCLhXuHLHH1AH5I1Lk' =H^_L9uIML9*HD$$E1D$,HD$HD$HD$`D$(HD$ Ll$fLkAH@IEXMuHHH HzL0HD$H#IEPLHphӸ{H{G]tz$$v7HLOH1P1LU H5#5IMI9IMI9fL 1ɺ H5޷Q5M11L%H55E1AD$0L H5uPD$HCS 1MLnH5JpH11AZA[HCH|$XHH L͵1X H5j1zDM6M9IF@Y tHHH9uIDt.LHHL11 H51IFHHH9tHKSLAutHLHH1LR H5A0]1XIFILC11H5 |0L 1ɺ 1H5V0L 1ɺ 1H5²00VHC@^H$HMpHLb ML輋 HD$8HL蟋 ȃ HD$HHxII9IGhHD$HD$`H$H$HD$NfMNH AL1H5ͱ19/XZHI9mHC8LpIFPL9uHt$LMn H|$H L HtQH4$@LA11AvH H5*LL$L.Y^IvHH|$8 HMNHHAL HMAvHL| H4$@LMEIFPHt$@Hxh.IFPHMNH1t$L H5N1t$-H vIvHH|$8L H|$HL Lς kIvHH|$0詃 HI~hI~p|  MNHHAL La 1ɺ H5,-L= 1ɺ H5b,L 1ɺ H5>,MNHHAL 9Lv1H5c,E1IHH MPLH51,[]1L1ɺ_ 1H5~+L=1 H5U+L1 H5,+H=H€!H=H€H 1PM1LH5%+A\A^L1 H5*5LH=#LREIT$PL)LAVPRM1P 1LH5~*ZIYL訌8LDIT$PHLxLP-HA11MH5L )^_bL; 1ɺq 1H5c)L1 H5:)MLM1H5 x)2HA11 MLH5ͫ;)AXAYL{ 1ɺv 1H5)NL-1 H5z(%L1 H5Q(L2CIT$PL LAVP AWAVAUATUSHHoOxoGhdH%(H$1HGhD$pHD$)D$P) $)L$` HLL9twL5 fDHmL9t_HUHHtLuHH;LH#HEHmL9uHLHI9 fDHPHRHL9u1AIL$`HmL9t2HEL`L2A!I|$`uHu1#HfDEHLeL9u fIHEHP<tYLzHLW}1L HAWMP@H5'1Ƀ1&H}AZA[6yI$LM9uHADžC`uHͯtHNttHhH(tH6H-LAŅ;uH_-&H-N L+AC`eH{@HX3ADžHLѧ 1ɺ 1H5g%RD1ɺ AL H5˧>%L1Lyy H5%H$dH3 %(D Hĸ[]A\A]A^A_L LHH5I1$E1띃'H,9LA9 %HA)7,H߉,HA+AU LAVL˿H5ǦP1U1$HH{H DHG蕇IH HCLx H I9 A@HCM?H I9h LuDAtȾLAuH{L-> L(DH*HD)LǃLuDkH;LH}HLC(IM9L|$@f.D$@IvH9t!H;rH H;pHH9uH~`LHGP@|$@H{(~@ HIVHHHP| I~LBH1ɺ AUI1H5ѤLZ8"HY^I@M6M9,L"H9u*LM| I$LI9IHrH;iu1ɺ AL H5@!fDHIqfLqAǺp H5k!SfDL 1ɺ~ 1H5ѣ?!'HCE1Ll$PHh H H9uZ@HvL1ɺ 1LH5r M H{HmHG H9sHOIE uHH;HLu-HEH@ HDH{HHЅ`AfLL7DK( 1AWLH5ɢP19 XZH;1Ҿ4FADžLL1 H5L L{L LHL 1ɺH5 }Lơ 1ɺ 1H5E1YAE%Lg L9t9fAD$ u"ID$H@(HtLHЅH{M$$HG I9uHAHL$HD$@o[hH$HLHHD$(oaHHD$@L=HD$HHD$8Ƅ$HT$)$)$Lt$@HD$8HD$ I9@LHoHh HD$HH$f$HvL41H5IL~1K LT$LLHʤM6L;t$(MfHLLD$ HT$LLHD$8H6H(H9u)HmH;l$8L)41ɺ9 MIH51YHLLNuL3LX1ɺ< IH51L3L1ɺN IH51L3L$A IH5M1HHT$LLt1 H5 w?L+E1 H5ߞM5L H5&L1L H5H{HmL%< HG H9u )fDH{HmHG H9E uHEH@8HtHHЅuM1ɺ H51LΝ 1ɺ#1H5d1L 1ɺ H5˝>H{Ho HG H9tL%r H{HmHG H9VE uHEH@8HtHHЅuM1ɺ H5^1D)H߉UL 1ɺ&1H5)Lۜ 1ɺ 1H5qFHE1LH5Ȝ;H{AXLAY4 Lt 1ɺ)1H5 LN 1ɺ1H5vff.fAWAVAUI1ATUSHTI}1ҾI!LcMIMH+L9uuDHEHL9tdHH{HGHP`L9LH)L9vktTHCLa1H2H5H@LHH1HEL9uAHD[]A\A]A^A_ÉD$ HCH.MLH5MH@pH1XZD\$ fAWHAVAUE1ATE1UHSHLHD$I9fAGL1ۅuA9_LH@IHЃ8uH@LpHEPHIv@H'I~@.HAIk2H1AVI1H5ZLTH^_A9_LrDM?L;|$BEtEueEH1[]A\A]A^A_fD#.HAI1H1ɺKAVI1LH5̙:ZYH1LRIH51H[]A\A]A^A_Hh1L1ɺWIH5X1H[]A\A]A^A_HHHtHHH1ff.fAWAVAULATUSHhHdH%(HD$X1L9HD$IIHD$fIH?HH9I~@IL—IHID$HxZ2H1ɺ UIL$1H53AAHZIYI;fHL9ID$LsHhILH腛HIF@A H+H1ɿPM1H5L I~@^_ALRIH?HH9LV(DK@1PCH1hIHt(HX' Lg_ MmM9uHLM9OE1D$H$Uf.[!UMPL11H5 IFHXZM6M9tI~@H脆uƄ$IFHx@HGtp UMLXP11H5A M6A[XM9uD l$t HrHڦR HLI9uf.HmL9cH}1#uHELGLHHH51 S HD$PH|$h(LXH|$1ɺL H1: D%PH|$L1ɃMLH5FHL$P1ۉ9DMLU11nH5tH|$L觰HH$(dH3%(HH8[]A\A]A^A_H$HT$H|$LHH$H$胀L$I9`L|$(H$Hl$MAHD$ M?I9MoI}0tA}<uL:H{HDŽ$Mu萸H}`LD$L1ɺIH$eDH8AE8A9H1ɺPH5L1Y^H}L! WEL|$(DL$ImLI9t)@a LIHHmH9uEDT$tE8H|$86K(LHD$XL$H"HT$`EN(LRHt$`VL$XH5ΈQ1P1;H L_ D$HHDŽ$LfDLl$8H9L( )H8IFH@HtTHL$uFHMHHDL91ɺH5+P1UAXAYD$@H_PML,1UH51Y^_DMLv11H5,]MN(IE0I97H1ɿPL1H5vXZfL91ɺ1H5Qf.A$A$ID$LH@PhL߆ 11 H5uL-l H|$1ɺLA, D$D` Lt$H\$LLHLLHH$HMH PL 1pH5YAXAYLHT$H|$@H|$L苄L1ɺ1H5rDMLtH5ՅCfHI9u_HmL9KH}-uHE LLHHpE1L1ɺ1H5Af.HCHHt/HIٹPLμ1H5k_AXHC@Ht.HIٺPH5΄LǼ13Y^HD$hH1fHML1UDLI 1ɺH5n@H|$NSH>fHD$Ht$Hx譁IH1J H|$11_ LL$LEpH|$L苁HD$HRL H|$1ɺL D$DML1H5^fH舋HD$@Lt$AHD$HH|$nH3HL$HH @ HT$  Lc 1ɺ1H5IELHx@H1ɺHAVIL}H5>1AZA[IELHx@<HI1IAVOLLH5ف BDML|$(EAF8HMN01ɿLPH51L$A[A\E1ImLI9DH訽A4oChoKxƄ$H)$)$L9t1DH}H@t谂uHEH@@H`HmL9uH$WHHH9uHH9HJA`uH= HD$XHh HL9H\$0Ld$XL|$8Ll$(IŐIEHx HD$HHQH(H9EE1F L L31LH IAHmH9L}AGauEtH5jLG uL| 1ɺ7 H5H\$0L|$8 H|$Xp LI 11 H5qHD$* ]L} 1ɺ'1H5 ~1@D$L} 1ɺH5}TM L1H5}*HRLf} 1ɺH5}H|$o1`vMLL1ɺ1LH5,}E+H58L LX D$ E1HD$`HD$HHHD$HH9Ll$xEDML1EuF;]L:H@HHЃ8uH@H@Lx@MAGauEu= L@ Lp1LH )EfDH5L uL{ 1ɺY H5{H\$0L|$8_Pf.DT$ E"H|$L1ɺM IH5{1Dt$ Lӓ1H5x{ljWHD$A Lz 1ɺ1H5${:D$DPt&CaHD$uDl$ExDd$tEXHD$H{d H{@t2Lޱ1ɺT1H5zH{@+HC@H{Ht2Lձ1ɺ[1H5]zH{HHCHHS8HCHsH|$0HC@H.LK}fH5yr DLy 1ɺH5yICH|$^1 1ɺMLH5yL|$(E1ɺMLڨH5[yL|$(L1ɺ1H58yML|$(ML|$(듿L611H5xAkL$ImLI9Lx 1ɺ"H5x@*Lnx 1ɺ: H5xH\$0L|$8HCHHt/HIٹkPL%H5Vx1A[]HC@HNHIٹmPL!H5x1AYAZD$p<ZLuHD$ L1H5w+sLow 1ɺH5wLKw 1ɺ3 H5pwH\$0L|$8Lw 1ɺH5Bw~Lv 1ɺB H5wH\$0L|$8xLv 1ɺ\ H5vH\$0L|$8YJLHLe1H5vA^XbI$1LLH5iv$L v 1ɺH5EvLH|$)1 HkH?1LLH5uWLLx1H5u'sLku 1ɺU H5uH\$0L|$8H 1LH5SuL$Y^1Lx1ɺH5)uHD$LLx11H5tVLLPoL1ɺN1H5tLRt 1ɺH5wtD71LLH5Dt81LH5't=Ls 1ɺ 1H5toa1LtH5sHNLs 1ɺd H5sH\$0L|$8H dH%(HD$1D$ jLL$NZYHT$dH3%(uHfAVAUIHATUSHH9t(HhIH;U@u?HhH9U@t.HH9u1Lr 1ɺH5rU1jHLL9tQDH{t7H{Ho~t'I|$ Ht/HSHLHPDJ HL9u[]A\A]A^fDL!r 1ɺH5Fr[1]A\A]A^f.@1fUHAVAUIATSHHHdH%(HE1DK AƸEu'H]dH3%(He[A\A]A^]DHHHBHHHHH)HH9tHH$H9u%t H)HLLd$1ILIEI9tLHHHHHJL9uHpDLDH*v.AVAUATUSHH $H IH=cLNHdH%(H$1Hl$HIHrRiMH@HLt$H$HFPL14 H߅ tH1ɺUILH51YL^1H|,IH(HAŅtqL1HLbLA,L褉H$dH3%(DH []A\A]A^f.HCPHDLH5LsH1XZkLLDIH51E1ZfDILީDE1 H5l)DILVDff.@UHAWAVAAUATIHSHHH8D4D0dH%(HE1G B1H HL&HMDHHHBHHHHH)HH9tHH$H9u%JHD$1HHH H@HKHHcHHǾ1 E&EH DDhAFIDuHDH(5H81HD ID4L;(LCP1H@I$HAE)EEuHCPH5H8OjI $Dj4ID0H8ZYjI<$LqIH51>fDHKXDEHDH HqÅ(H}dH3<%(QHe[A\A]A^A_]H0kH8L$H5[Lk 1ɺH5A11ckfDH)HLf.HLzIH51I<$LæIH51ML11H5Lj 1ɺAWAVAUATUSHHIHHC ADžMIHD$L9AELI8E1H@LuHXL9u/uDIFH@@HtHK@Ht H@8H9A8tM6L9tHIvHctAE;eLsDH@IHЃ8tMmL;l$^AHD[]A\A]A^A_fDUHHE1S1HdH%(HD$1HGPHL$H8t*1ہ|$HT$dH3%(u>H[]@HL=IH51SHHP裥HCPuH8HOÅt"[ÐH8H޺[1Lh 1ɺH5Ag[AWAVIAUIATUHSHHHHGPH߉T$ 1L ƺML9uRfI}P臽t I}Pʘu~LϤ1H5E1sDM?L9tIWI|$HouD$ L1H5]DT$ "@D$ u0LMAHD[]A\A]A^A_LhttLt(LLNuD$ L^g 1ɺWDLD$ tLIH51DT$ iD$ Lg 1ɺH5w1DT$ 7D$ Lf 1ɺff.AWAVIHAUIATAULSHH8DL$薖H9tIHL}$IH51E1H8D[]A\A]A^A_DH@t79ZED$L$uL}LL9u@M?L9|HCPIWLHxHu܉D$6LH581\DL$CfL1ɺ)1H5 /A@ML?HLLothHfHHD$(D$HD$D$D$؈D$t$(t$(t$(t$(rH HL HLXLL*LeHL9tIt$HM$$L9uA H{P蟹tH{PLSd 1ɺ=1H5ÜE1LBH5LeLL9tfDIt$L[M$$L9uD$tHI*H{PtH{P4LU1zH58E1!L/H5E1D$LKc 11?H5DL$LVH5LJH5cHLcJD$jLΡH{PHE1AD$tLHL:]IH51DLOH5Mff.AVIAUIATAHVUHSHdH%(H$1HH xgMHD@1b5HH1HLTt`H$dH3%(HHĐ[]A\A]A^fDILn11۹H5̙DL9a 1ɺ1H5zf.L a 1ɺ1H5yJDUHAWEAVIAUIATESHH(M}dH%(HE10H_H8HKHHH5HML\HMHtoH)HHPHHH)HHH9tHH$H9ut H)HL4H|$HHHL[H@DH{PLIHm}v:HDH9wxjMLE1AWALLZYM1ALLLH]dH3%(LHe[A\A]A^A_]L)HAnL_1ɺQIH51=DH@H5kHxH|HKHLHIL1E1[H55[.fDLE1UH5+fDL91HH5֖fHWX1tƀtHHHf.GYt>S ]HH8t 1[DHxtH[H@fD1DSH5HHdH%(HD$1D$HtsH@ H@XHHHT$1ЉÅt(\$HL$dH3 %(H[DL9] 1ɺ]1H5DL] 1ɺW1H5DL\ 1ɺZ1H5YiDAUATUSHGYuH[]A\A]f.H[IH@@ uAmLCY uŅt11ۉL$@IIL8tA;]LrޅtH[]A\A]ÐHxu fDIJ| GUHSHHHHtbH@@tHH[]fDH}H{1HHLYUI1H55XZ멐H}LIH5ܓ1sff.҉USH։HH9w\H9vUҹ)HEuE8H0/1I麬LH5V@11vH[]DL1ɺIH51?H[]fDAWEAVAAUIATAUSH(HGPT$ 1LD$Hj1LCZ 1ɺxH!H5@HH聎HI}PHD$AHDH AIIEPAL\$tzAUE1ɹjI}PL1AWt$(PjDD$E1H5}1E1HT$XdH3%(D8Hh[]A\A]A^A_Ë$@\$tAL$9L$0tD$D$(>1ɺOD$LD H5j}DT$rD$0AD$LODL$0EDD$,E1E1EnI|$S-H|$ tHt$4ÅQLl$@I9CLd$IHl$ MmM9IuHu1ɺD$LD H5|DT$1ɺnD$LC H5f|DT$nH\$ E1HLH}1ɺIH5/|1SL{HIHH!CX2'MIFXĀL1oBLIt1L&IH5{1A}L#Lt$Lt$ L|$Ld$PIHRL<J|9HgXILHJT9IT$ A9]LIFPHHx IHuLB 1ɺ1H5z E1D$L]B 1ɺH5z1DT$LILd$MtH|$ L`aMtH|$ LD\|$0XHD$8HtT$(H|$ H1ɺPDL$81LL{H5!zLZAY&D$D$(D$0H|$ 0I$LxIgXLL$H|$ LIXD\$4EtH|$ H5H|$ CuHHT$ H!BXH|$ @DT$,IEtMu HIHT$ BY ;HH°H9$HH0 HH9uH|$ ?LOI|$HbpHt$ E1HڹH~PLHH?|HLY@D$L@ 1ɺf.Lt$L|$Ld$L#tlLM.D$L? 1ɺhD$L? 1ɺQD$L? 1ɺ:D$L? 1ɺ#LD$LtIH߉D$xLID$L&? 1ɺ|մD$~1LkxH5yw蟼DT$|DAWIAVAUIATUSH8H|$Ld$$H $DD$ dH%(HD$(1D$)؉ÉD$LMI^fUDE1LAUDD$LHL$Y^L$$ED9AtAL)IHty+\$$Mt;t7LA9=9XLwL,=DXLEsfAA)MuEtAucHt$(dH34%(DH8[]A\A]A^A_DL$$Ld$11ɺ$L= H5 v6D $;\$tIH|$H7Lt$ VDL$,H5uA)1XE1ZNL13H5u轺E1"AUIHATIUSHHdH%(HD$1[ tNL11H5*uPHT$dH3%(cH[]A\A]Hu\D$HcX1- HHnLHAKŅwHL$E11HL;Ņ|$u HH=H1DHH! ]@HFPHe1H5yLpLqH1萣Y^cfL% 1ɺ1H5x_4f.L% 1ɺ}1H5x/f.Li% 1ɺ1H5\xf.L9% 1ɺ1H5,xϢf.AWAVAUATUHSHHdH%(HD$1HHE@ G\ #E1HL#2Lip1-H5w4LM$$H#HH9DKAAuDD9Ku(1E1LoH5'wʡ;H}E14L`oIH5v1荡HL$dH3 %(DS H[]A\A]A^A_H{H;}ͻ Lv IH5v1&HA HUHBPHH}`HtHpE1H0gAƅxHt+"E1ҾHhAƅoHHqAƅH}XHtHUAƅH}HHHL+H9u*HIUHLI9IHsHF@tH;~XuMtFHGPHv1HxwHHULHRPHzHAƅ HsH}蟘AƅHCH}H@X_HpAƅ]L! 1ɺ 1H5tTH}XLpD$L IHL ID$HL HHHEH{pHP@ooHoP oX0HS@HPHKHSHHPPHS HSPHCX[0 M|$HuXAI_H%HT$LHdLHL!HEHxPLH Md$MLHEHHAH!PXHHpX4HDžJH}E1DHH(HH5rSILk1荝Y^fDH}`8HI HEH@P@H]`HEHHHLHLL[ 1ɺ1H5NrH}hL|kIH5 r1D$tHEXHǀLL? L 1ɺ1H5q~L 1ɺ31H5qE1ZDHHHH9udDLHAƅHuMt"HFPLLHxAƅHuHH HH9BHLhHFP1HxSHu1ɺaE1L H5p蜛 L 1ɺH5pxL 1ɺC1H5pRL 1ɺ61H5p,Lp 1ɺ1H5cpH}}L9iIH55p1֚L 1ɺ1H5p赚H},L@iIH5o1腚T$HEXHǀL 1ɺ?1H5oDL 1ɺH5xo H}藴LShIH5Oo1LL腴 L) 1ɺ1H5o这L 1ɺX1H5n蜙 HvX$AHDžHEXHE`L 1ɺH5nLL 1ɺd1H5n&Lj 1ɺ<1H5]nnLD 1ɺH54nܘ1ɺQE1L H5 n赘#L 1ɺT1H5m菘L 1ɺH5mkuL 1ɺh1H5mEH QHE.ff.ATUSHwHHH9H1HPHzG^uHu=HHH9uHHHFXtHCH@Ht^H[]A\ H{IH}HATLUfSI11H5lGXHZ[]A\H赱H{H話L`fIHPUH1耱LfIH58l1ٖ9@HF u@t Ǯ{xff.<AWAVAUATIUSHHGXH%RH-D$@ID$PLE1L(E1HLxIIǰI9ufDHL9tPH8uH@HxIHǤIMtMHML9uMDt$LT$I w M9 L&LLILHLT$LHLHLJeAWI1UH5jS;H H[]A\A]A^A_D$IHI@LLeIIf.L8LT$@TL9H[]A\A]A^A_LL4dIH5i1qH[]A\A]A^A_DfˮLcIH5i1$1LL袰LH臮LHlLpT聰USILdH5"i1ȓXLZ.LT$DPTAWAVAUATUSHHDD$DdH%(H$1E@F@ALl$0HOHHIILL=HLD1b HCPH5H8IHH3膢t"HE H@XHtHKP11H9ЅjDLAjIHٺ^_1$LCPL1tIH11HHY+jHDIjDL$1LeZY3AD$@HgHSXHH gHDHCPH8@0HH$HlHHIފMfHL/LLdAu\L 1ɺPH5f蛑EfDHLbIH5f1aE1H$dH3%(DH[]A\A]A^A_f諫LaIDH舫La1ɺ IH5Cf1CL! 1ɺ1H5f跐E1QD$L 1ɺ H5e1胐DT$fL 1ɺ9H5eQ̟H|t(H{PgtH{PBf.LY1ZH5IeD$LM(LZH5e1贏DT$Lf.L 1ɺMH5d聏+@H{PD$ fDT$ H{PDT$ BDT$ HCPHkX,HH8NDT$ gfDT$ H)D$HD$ D$(D$,t$(t$(jj?H DT$ OHCPHsX,HDT$ H8DT$ HDT$!-L`IL 1ɺ61H5c_ f.DT$L 1ɺLy 1ɺHH5ic@LQ 1ɺ=H5Ac@L) 1ɺC1H5c迍iH2L^!IH5b1苍5HDT$L^'IH5b1RHCPHsX,HH8DT$}6fDAUATIι8UHSHdH%(H$1HIHH$t$pH5D$H$$HD$$IH$H$HEPD$(H8D$4D$DDD$tD$HDŽ$$CH$Ht_H}PL{HHHEP1LHH8KtWH$dH3%(HH[]A\A]HL. 11zH5!aċfL  1ɺ1H5`蟋DL 1ɺ1H5`w[}ff.fAWI1MAVIHDAUIHATUSHI0LHH9HMHL蜧LI聥HuLI肧HzAT1IمAWH5+` @Lp\11輊HuA[[DLHD$@tH[]A\A]A^A_DHD$@DEH]HfDJD1HHHH9sMueHD$@tHL迦HuLI谦I1ML\H5Q_@H11AWXZrHLeHuLIVLH;ATH5_SIL[1葉^1_HLHuLII1MLC[H5^@H11AW.AXAYD1Lg 1ɺ$H5\^H1[]A\A]A^A_ff.AVAUATUSHHXdH%(H$1HCXH(DH(HIHLJXHCXHHsHLA~ _L~H1LHHL謢IAT1MAVL[j@H5U]11H}XHZ1LÅ111HH$dH3 %(HĐ[]A\A]A^DH[LZIH5\11gDHءOLZIfLH5HHLYZ1ۺdH5Y\1L9 1ɺm1H5,\φ~DATUSHHLgPdH%(H$1I$XHt H9LŅHHKH1H[H}s HLKH1ɺ;ULFZ1H5s[I<$X1ZHH8ŅH߽QHkX(I$XH$dH3%(HĐ[]A\fDLKHL}Y117H5Z莅@L 1ɺ21H5ZgDL 1ɺ=1H5Z?WE}DAU8IATUHSHdH%(H$1IHLHHH}$HDH5Ll$I$D$D$(D$4D$DD$pH$HDŽ$D$DŽ$H$H$;H$HL1ɺ1LXH5Y1LHfHHH}Ht:HBH$dH3 %(HH[]A\A]fD麩1LBXH5Y讃@HL 11H5X脃fL 1ɺ1H5X_`f.L 1ɺ1H5X/05{DATI1USHHHXHHuqHLI9ILGMPXtEA9vDH9DH?L9uӅSH[]A\8H9GHWHt$ HHt$ A9sHtCL1)LSDK8jHAU`RATVL։EH ÅkLG 1ɺ1H5:W݁JDƅEH!H, LVIH5V1腁H;1ɺH#ÅL 1ɺ1H5VHLV1ɺ1H5|Vf.LHHiLE 1ɺ1H58VۀH6fHGH@`HtSHH9vH[f.f.SH33u[DAVAUIATIUS 3teA$u]ID$L0I.LL9uHHEHII;l$t/HLLQ2tA4$LA7I|$H fID$HH+H9u@fDHEHI;l$t,HHL1tA4$HH6HEI;l$uA4$L6[]A\A]A^@HG`HtHp8HHx鏜 1DUHSHHH~@וHtHHH[]Q HHZooNHOHtfHHxHHHxU;DHvPHt Λ fD1DHvXHt 鮛 fD1DHG`oFxoHO@HG@HHH鷔H@HH@dH%(HD$1H*H$u1HL$dH3 %(HuHuDuHf.HSHHHtHt H[+[HH@DH@H@H@DDHHw@1HtHHE@1HÐHHw@1dH%(HD$1D$UH1HtHT$H5*ED$HL$dH3 %(uH,tff.HpSHHSruHSpH[ff.@1HpÐHHff.fH`tESH|t,HC`1@Yt Hs@1HiHtHF‰[1҉H#LIH5P1{DAUATUHSHHHTH}@AH߾AȘ HHtxEuStRaHHൃxCH%HmCHH[]A\A]DdE-uOˆ@Ls1H5O4zfHHw@1HtHH|E@1HÐHdH%(HD$1H$Ht3HH5BH$HtHL$dH3 %(uHD1qff.@HHw@1}Hu1HÐHHd@1tHff.@AT1USHH0Hw@dH%(HD$(1HIHChH߉,$HP H0HT$HDHD$HT$t(HD$HH9tG4$H/HH;\$u-HHJ9t^HH5LdAHL$(dH3 %(umH0[]A\fD1L 1ɺwH5M/x1HLMH5ML1w1off.fSHw@1HHuHHt5H{@Ht,`LMIH55M1w1[DH[gBAVA1IAUEATIUHպS1VH5OAPLXM3wHEZYH9tpB|+9HH9tVP9wHу9rBt+AVA1L8MQR)VH5.OvH 1[]A\A]A^L; Ht/XHHDh []A\A]A^fD@L끹LN/H5NUv1AUIATIUHSHm LHHqu)I9,$tH9w AEH[]A\A]H1[]A\A]ÐAWAVAUATIUSHXdH%(HD$H1HFHx@HtIIAL ŅtKLL11H5MuuH\$HdH3%(nHX[]A\A]A^A_I}'IEtLI}LK1ɺHD$VLL$IE94L3L9t-I}IFHW@H9P@u@IFH9P@tyM6L9u(LA IHdAoELAAoMANIE IF HZHHD$ HD$HLIF I}"Mv HD$MHD$4HD$ HD$@HD$HD$nifLFH5wF1E1 n4LoF1H5IFm L F eAUIATIUSH2 HHH I$I9u0doHHoKHHS HP HL9t6(L؇ HuLD1 H5EmHH[]A\A]L|E1H5VElf.AWAAVI0AUAATMUDSH詊 HHt1LpHDxDhL` h( HH[]A\A]A^A_@L8E1!H5BE\lf.UHSHHHHGH HtHx t5HCHH HtHx t6H[]f.SPHHD$ HD$HH뫋PSH H[]fDUSHuH[]fDE1E11HHtHH H[]L 1ɺ91H5D7kDAUIHATIUHSHQ H]H9uffDHLE HH9tMKSLHsDK(LC HuL 1ɺJH5CjH1[]A\A]fH[]A\A]ATUHSH9HLI9tfC9r K9rPH[L9uHT$ HLCPT$1H5BAѺ jX1ZgD9tlHs)E1E1 IHt`@)CLHr HC HtH@HKAT$H@P)HtLeH[]A\DIE1L 1ɺm1H5HBbi1L 1ɺH5'BAi1ff.fAWAVAUATUSH+>HdH%(HD$1H$HtxIHAAID$HHEH@PHxAtmID$1C.HH@PHx"tNH$HtmHCLc D{(DID$H@PD)Ht$dH34%(HusH[]A\A]A^A_L 1ɺ1H5%A1=hHHLAAVI1H5@hXZz`ATUSHHPHdH%(HD$H1H{ HG`L1Ҿ3Hx+u)HL$HdH3 %(HP[]A\DH{H{Hw@HHG`H@HbvHtHCHp@H@`H@HavHwHSHs HC)FPHIuIHz@}ALfx@IL6@11H5>eF[HH5>SIL?11eY^]ff.USHHHG HwHPPH@H@P9tqWHx)1Ņt+HCH޽H HunH[]D1Lg 1ɺCH5=dH[]fD)HG G(H[]zf.Hx tyL?11H5y=d`fD_H1[H2L?SI1H55=OdXZHH[]fFGH ff.AUATUSHL'L9I1H- ?f.MT$ MI:I9tpIt$LHI9tILfDHH9t6Hx uPO9ADCPO9HGщD)A9FH9uH?I9uM$$M9mH[]A\A]ID$Hx@yI1ɺwIH5;1cM$$M9%H1ۉ[]A\A]@AWHAVHAUATUSHXHH|$HHL$(HD$@D$D$<D$4D$8H9fDHD$(D$81D$0H@LHD$HHD$ L9E1DMAD@ H@LXHAEEgEwL$H|$DD$ D$SDD$I1APL\$L:H5:ASATAVAUaAGH09t7HAPL:1H5:aA^XD$IG HH[HHHڃ:t:1L:H50:JaIG D$HHL9zt01LV:H59 aD$IG @PEOD9t9HL4:PH591`A\A]D$EODL$0DM?L;|$ t8Dl$IG A_(HQE1LNfEOM?DL;|$ uȋD$4l$<+D$0D$4HD$9t7HAPL;H5 91"`A[[D$HD$t$09t8HAPL{;H581_AYAZD$HD$(HHD$(H;D$@$HD$HL$89t7HAɿPLH;1H5V8u__AXD$HD$Ht$49t6HAPH58L';1+_Y^D$HD$HL$<9t6HAɺPL;1H57^XZD$D$HX[]A\A]A^A_DAWAVIHAUIATUHSHH8DD$dH%(HD$(1HD$ \IHC`@XHCpHH$+Ht$ HN ADžHt$ HtPH9s |$H9V1MUL;1ɿH56]XZHl$ HHM1VL;1H56]Hl$0A[A_貴HH9vH9hH{`HLHDHGP0MtI ML611H568]H<$ADždI} H> HtAHLH<$u LV4.LI1MẳL16H5{5A@11\1MsL8H5A51E1V\HL$(dH3 %(DYH8[]A\A]A^A_ H#HL :SI0H541[AYAZL< 1ɺ1H54E1[tf.E1My1LH5o4[.@HLxU1H5G4PML81O[Y^WLwHM1PL71H53[AXAYDT$Ht$ ELwHLIrwLLH=7H1f.H1Mt$L:H5W3qZXZE1E1L:H5%3?Zf.HHH=HL=8IU7ML9H52Y_fDHL$8?IH521Y@LvHLI vLLH=6H1賣6LT$IARXHLT$$2$L5IRLT$AR$Lw 1ɺH5.VLS 1ɺH5.UMSHHNDN H9tHP;Hv09Hr+HBHPH9uHs HS P[f.Hff.AWD AVAUATIUSHHH<$HDVA9AF9wJAHAvt$ H9t1CCP9r H{ t4HHH9tD9vH[]A\A]A^A_f.D|$ H<$)(A)D9DFr IHtiI<$AWL5UI6H5B51TMeI|$LAmE} E}XZ1CI $CBfDL 1ɺ31H54/T1Lv 1ɺbH54TH1[]A\A]A^A_ff.fAWAVAUATIUHSHHt$q HH H M<$M9u,WHH!HM?M90HIHH!HuuIGH@@HHLjH9uIU LjH9HRH;B@uMw MMM9uoMM9`AJARLHL$UL$uL 1ɺ|H5c3RL 1ɺ1H5G3RHD$L3H5 3L1]RHH1l HH[]A\A]A^A_fD0Hp IHIGI}IEN Iu HR Mw MIE1LH^JL 1ɺtH5l2QfLk21H5F2Q7L 1ɺ1H52_QH 2H51H=2Aff.USHHH H;C )G9w*r H[]fk)HHC 1҉CH[]H :2H5~1H=1RAfSHH菫 H;C H޺)GH[@HH9HPtHJ BHQH9uf.DHpLtlVL1H|R1HfILHt6HIXu*u"HHtHLHt HIXtHH9uHDtff.AWAVAUE1ATUHS1HPLIDžDL @IN$L8LpMHLHIFXHt%HH IFXIJD H pXIFXHHtHEH!IFXAE9oLNtAGHH[]A\A]A^A_fD1L 1ɺH5/wNH1[]A\A]A^A_fDAUIATIUHSHEA$AE\tiHLtbH:ufHJ1Ht]H-A$9XLv*H IH ʃ9u-HIHt$HqXuՃE9XLwH[]A\A]1L/hHAٺPL31H5 /MXZ1H[]A\A]@AUIATUSHHIEI1C\t[AT$LtR1DH@I$HH|ltI$HD@YuIEA9l$Lw1I}H[]A\A]fUSHt2؉1HH[]H1HHH!H HDH+CAWAVAUATUSH(t$P(HD$!@L&HD$HH@HD$HpD$D$tHgDL$1L1{H5-K1H([]A\A]A^A_DHD$H|$D$AD+o(t$H|$i1HD$E1LH|$DIH[DD;l$s.A^$LLI.Ac EtM&ID;|$rH|$HHH9t(11ɅuHt$N(P P$H(HH9uHt$D$D$9FLD$HL$H@HHH@HD$HL 1ɺmNHD$@(D$H|$DKtHD$LfDL 1ɺ1H5+_JH(1[]A\A]A^A_fDL 1ɺdƸ2Lw 1ɺff.USHHrHHHodHL/UI1H5J+IH1[]f.f.UAHISHHOHdH%(H$1H3mH\$H0mHHI16 HH}PHT$ HHEPu>HxHRf HHH$dH3 %(HHĨ[]fT$ L eH/?SH58*L.1A mGHsX"HHuX!XZWHOLH4@tLH%@u91Lx 1ɺK H5(G1H[]A\A]A^A_I$H5)HB(I$B($HCHHtCH5)HHEHHtNH$H(HD$HH[]A\A]A^A_L 1ɺQ H5'YF1DfL 1ɺT H5'1F1f.AWAVAUATIUHSHHt H8HXLL=ɼWHHIH LDID$PHHxR` IHfHI1LH giH2 DID$PHHHx` HD$H"H|$1ILH 'H2 AFL1ۅuBIHt!Ht$Hl(LxHEHHA9^Lvb؉LLH,@IHL|(?IGHHuL 1ɺH59&DH1[]A\A]A^A_fDH[]A\A]A^A_@L 1ɺH5%iDH1[]A\A]A^A_1L 1ɺH5%/DH1[]A\A]A^A_ff.AVIAUATUHSmHH@@{Lt6L+H5K%1E1C[D]A\A]A^HEP0Hx.^ IH2HHxI}~HHHx[yL! 1ɺ1H5> >fAWL&AVAUATUSH(DoLEHGHAH@tB uB1L 1ɺ H5J>H(1[]A\A]A^A_f t tD1D1DHAHH@H@PHx[ IHt`A^D9CLDDu/7SLA9vkISL9JI49ZAߋSL1tƒA9CLwD9"ADE1E1D|-tuELDA)D΃A4A9t'H4RItF[uD9uىA4A9uD9tAG7E9Au1LU$dH5&;H(1[]A\A]A^A_fDH([]A\A]A^A_H{UHH@HH5UIL]#14;Y1^SLAH{UL{#;IH5y1:1fAWAAVIAUATIUSLHdH%(H$1HI9HI9tVLW#11H5h:H$dH3%(HHĘ[]A\A]A^A_@L]HIH1HL<' MD$P1LHH֏HHMt?ID$PH5:H8qIHjHE1SDLiZYtvH莕!fL)HHIt$H>fDL1SLZ"IH51/9f.M1Lr"H58@L9 1ɺ1H5V18`M 1L!H5 8,0ff.@AWAVIAUIATAUHSH(LD$D $ȹHDH4@IEPHHxR HD$H'1L萑Li 1ɺ4IHHCT$H@IUPH:UH5Ho8HD{L 1ɺ=HH$NH8NAKL1+NH4$HtH袒 H4$H$Hl$1EfDMtDHT$A1LIHH@LÅLL$pH5<LH5ILUH5;L7H5} L 1D$L H5XD$H\$Dl$(fDH|$0&6AHH O-HNPL1ɿR1E H5j_AXH<$>w A9MIcH4@HD$0HH@PHx5 HD$HHHD$0H5aH@PH8HD$(HwKLl EHD$pD$HD$8HD$hHD$@SfD3Ht$(H;pDHJ| Ht$(H;p$@EKL1HAO$vMIJ| 9sH4$螩HL$8HT$@DHAaDD$EHC@H{41L=IH5i1KLȅth1Hl$XE1Dl$\H݉DL,@N4J28 HB4AA9rĉډHDl$\l$X)ЉCL@HcD$HL$HAHT$hH|$IH@HAH4LdHVHD$pID$us H|$ LD|$cs ~fDL4$HdLt LH HEt E SH5GLP1YE1^H\$xdH3%(D HĈ[]A\A]A^A_Hx2IHJ|02SL1AWIH51EA).HH}H5JL0HL$`XZDhHL$PHAHHHH}DH5;JL0HL$P2HL$PHAHH HK H4BoJD2HD2HBo  JL0HL0MLfDH<$r uHt$0HvPHt$PHH9$8HJ| 1HD$PHJ| 1H1ɿHT$XI1LH5wR A\XE1LH5@L H51E1DHH4$J| å%fDL 1ɺ1H5?DL 1ɺ 1H5D$D$LX 1ɺ 1H5uD$D$0Ld$hDuLDT$LDDT$H9EAFLIT1f1ɀ?AHH9uEE1H\$EL4$LDl$(IDT$80HD$h<AQACA9GLEHqH [ILL,J|(auILJ|(IuAE0L #H|$0$;/LHKvIHx /HLUI H51tAZA[D$L 1ɺ H5AE1D$ LH51D$DT$8 LD$뷹LH5;L^H5L֕ 1ɺ H5nE1HL4$HxL蟢DT$u HLHx胢DT$vD$ L$HJ| x-H|$0Hk-HLSI H5H1XLZ H5"1D$ H|$0-H5$DAVIAUIATIUSH*H9u'fHuI}c{ÅHmI9t@H}wÅuL1?H5[]A\A]A^fI,$I9u#fH}zÅHmI9ttHuI}{Åu1L 1ɺIH5[]A\A]A^D1LǓ 1ɺDH5_[]A\A]A^@I}Åt=[]A\A]A^Ð1Lw 1ɺKH5[]A\A]A^I.Ll HQLUA1H5TXZfDAUAATIUHSHH?%Mt Lk tH[]A\A]f.HLHÅLj Et HHH}ÅuHLk HLAUI0fDHLk HLUA51H52XZH[]A\A]@L 1ɺ=1H5wfL 1ɺC1H51MAUIATAUHHSHHkLCXMt9ILCXH1HD^Ņt(H[]A\A]fDIHH)L/LIH5*1H[]A\A]@AWAAVAUIATIULS1HH$HL$ӏIfD@tpLHIutIFHpuID$PH8HtHH<$HEHHD$Ѕu$LS 11:H5p D$ AHD[]A\A]A^A_AWAVE1AUL-`ATUSHH8dH%(HD$(1D$L|$HD$ HD$HhL`LHD$ H$fH$MLLH L1LHsIHuˋD$L- HuLFHD$H{PHp8H|$I˗HH$_'HLAUI1AWHT$H52R H Ll$ 'E1H NLLHL1LHIHu1H\$(dH3%(H8[]A\A]A^A_L 1ɺH5 H&H|$HۖHLSI1H5V XZhL 1ɺH5# <ATUHSHH9hEt|$ L%rtLe(H3HH%ATLUI1H5 XHZTt[1]A\fLI 1ɺH5c [1]A\f.H訕HH=%HLIUnff.@E1E111HD$ D$D$@H'ATUSHs H-\tH)H請HHI$UATI1LH5 XHZ4t[1]A\fL) 1ɺH5C [1]A\f.HN(HVt$;ff. t 1 tf u 1 uT@t u?t @u*HHH1H8HfDATIUHSqH8u5I$L9t@HsHHI9u[]A\LH5H=ÅuH #L(IH51y[]A\fUHAWAVAUIATSHHHHdH%(HE1衉HHË@L%HHHH)HH9tHH$H9u%DHEL H'HHCL`A HHHa H HHa H0HHa AE[tIEPH@L蓹HI/L9twIIL1f.HEHDII9tNHL Iw1LDcÅuL5t 1ɺ^1H5RfH[]A\A]A^A_f.AWAVAUATIH4@UHHSH(D$HH $H@DD$H@PHx Ls 1ɺHT$IŋD$Ll$MHD@MtLH HHD$fDHI9eHI9tfL L1H5BLs 1ɺ1H5!1H([]A\A]A^A_fLH+D$HHXH@H7{HI H1ɺAUI1LkH5"HD$H!CX^_HLHHH5HHHCHHL$I_H<$LI J M9D$;ELH([]A\A]A^A_ÐLH+D$HHXH@ f.Lq 1ɺH5A@H0UYLqq 1ɺH5 I@LIq 1ɺH5c!@HI9tHDžHDž @AWAVAUATUHSH8dH%(HD$(1oIH@H@@<I$SLl$LH ID$HM$HD$ L]IH51AT$LE1LHLJÅID$IDŽ$@tHEPH8HID$HHbJÅH}PLt$M9uM6M9HEPIvH8tVÅuLo 1ɺp1H5-LI$ui ubHt LKo 1ɺU1H5h1HL$(dH3 %(H8[]A\A]A^A_f.HRDH L$vIH51qLt$M9ufM6M9HEPIvH8$VÅuLn 1ɺy1H59LYn 1ɺi1H5v f.L)n 1ɺ_1H5Ff.L 1{H5L迢ÅHD$M$H1IID$ LIH51(Hl$L9ufHmDL9H}DsSGHUM1L@ÅuL#m 1ɺ1H5@@Ll 1ɺf1H5f.fDL1}H5LhRfAWAVAAUATAUHSHH(kIH@H@@tEuNE@DAH߉D$衼ADžvEeIEHL5HIH@HMELE AWI1LAVH5rH{PY^wADžHH5O-HADžADžwL׵ADžlB;EImHDDd$EEADžk1;H1躢HADžEADžbA6@HE1%L IH51~H(D[]A\A]A^A_@LsPHLHL}(HD$IuLHD$wLHD$ sLL$HL$MHT$HH=1W2@Lj 1ɺ 1H5fLi 1ɺ1H5of.HLIH511@LHqHLSI1H5sXZgD[LHqHL@IS1DLh 1ɺ$1H5 f.Lh 1ɺ,1H5_Lh 1ɺ51H59@AUATAUHSHHDl$@gHDHDH[]A\A]@AWAVE1AUATUHSHhHT$@HL$HLD$PLL$XdH%(HD$(1D$ D$ IH$HD$HD$0L`HD$ LhMt5Lp H@(D$0Ht H$HЉÅ'HAÅH}P1LgÅH LoIH5w1Ht$ HAÅMtLHAԉÅH7 LzIH51H?AÅ'fDLf 1ɺd1H5GHL$(dH3 %(ZHh[]A\A]A^A_fHEPLH8PÅHLZIH5a1fDD$ =JLf 1ɺ}1H5KfL11OH5l Le 1ɺ`1H5?f.Lye 1ɺq1H5f.L81uH5cfHN(HVt$[ff.HN(HVt$;ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt${ff.HN(HVt$[ff.HN(HVt$;ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt${ff.HN(HVt$[ff.HN(HVt$;ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HAVAUATUS9v|9w9tXI\IID$PH8ZIID$PH8HAVb1AUI1LH5XZ[]A\A]A^Ӊ[]A\A]A^AVAUATUSH`HŅHH*A9tmHCPH8IHCPH8HIH5AV1AUILB@H5T11ɃDXZ[]A\A]A^fHCPH84Nff.fAWAVAAUATAUSHH_EC\qHHeHpHF SD9H8H(DHTAŅDDHD9VEHHt 8H萰AŅ=HCPH8CHI(HI}hAUL1ATIH51uHsX H51H߉D$Lp6 IH5~1DT$kA]DLl9 H58AHDT$H1ɺ UILH51tA\A]DT$fDD$LQ 1ɺ, H5İ1;DT$Ll$PLc) fDD$L]Q 1ɺV @L|$PHD$I9-l$(LIDd$,$@HEHPHrHHUHHrHL9L0* H9uӋT$LeH5_HID$HHnHmL1 H5\H\$PHl$H;\$uf.HH9xH{[6uL`P 1ɺ H5zGH(EEu>HSHH8OHXH iHH=wH1L_ 19H5AT$LLLHA:ADžIDŽ$H; LH@IH51HFHLIƅ1bf.@mL LIH5æ1:HI#GXH IGXA;nLxI1H5jH@HHlLx1IH(+HoMOHL?H5@LG 1ɺBH5!1E1$LF 1ɺ71H5oHL$(dH3 %(DH8[]A\A]A^A_fALF 11,H5f.Al$LfHE1HLEI1HeH5wP1AZA[zfL)D 1ɺ51H5FKf.LC 1ɺM1H5f.LC 1ɺJ1H5_f.LC 1ɺ.HATUSDd$0HHl$8BHHE1ADD$ []A\DAWAVAUIATIUSHHt$dH%(HD$x1BHMHPLALHHAŅHDžHCPH8wHEHD$AuCHL$xdH3 %(D&HĈ[]A\A]A^A_f.fLH}AŅu)L"B 1ɺs1H5?踿fDH{PL߮AdH@H|$PHD$H|$ H LIH5Π1EH@IHD$`HHD$h AFLH4@HCPHHx HD$ HAFLH4@HCPHHxx HAVLE1tTHl$(DL|$H\$0LI@HH@HI4HDLHF ;kLrHl$(H\$0H|$V H4@HCPHHxG HD$0H/L|$`L;|$AD$(Ld$HHl$@Hl$I H5IL1HCPHL$0IHI9ŋD$(IEH@L$ID$HHD$8MLHD$( Ld$PI9u~fDM$$I9kI|$L^uL? 1ɺ6H5͞KHLGIH51HLIH5v1L6? 1ɺi1H5SE1ɼ@L ? 1ɺc1H5&蟼gf.1ɺoE1L> H5n6fLt$PI9uM6I9I~L(uL}> 1ɺ)H5M?L;|$Hl$@Ld$HMt&IEI9tHHPHH!I9uHE H51IL1螻H|$rL|$HD$ HI L"IH5М1GHt$LHL%IH51 fHhLDIH5J1@L= 1ɺH5虺I@IHt$8LILO-IH5қ1I@L< 1ɺ1H5Lc< 1ɺH5}AWAVIAUATUSHHHt$HT$dH%(HD$81.;IH@@tL11HŅH;H|$ HH<$ DEULE1E1fDA1Ʌu$@$A9DGEL9DL$H@HHH|HT$9:HT$L$HuHH|jHLATIH5A1轸_AXL; 1ɺ1H5 虸H1LIH51hH\$8dH3%(CHH[]A\A]A^A_E}E1;ULHH@HHxD;sDT$T$uL+: 1ɺoH5E÷L : 1ɺ1H5)袷DA@H8H5hHD$HCPH8 nHT$H2HrLDE1jE1jjzTWHjAVVR8HjRD\HPHH<$Hc ULAED;Lt$ E1D$L;4$GE1u=ffD1HDLHD$k:LD$ULAA9Dt$L$@HIJ| 7HuHJ| HID$L'H5P18ZYLy8 1ɺ~H5I@LQ8 1ɺH5k!@L)8 1ɺ1H5F迵Rf.Ap$M6t$L;4$HL$AHHCHN H4$Hn HCPHsX H54H8kIGHD$HŅuQLb7 1ɺ 1H5L97 1ɺH5SѴ3@H{PHt$FfDL6 1ɺ1H51腴UL|MHLSIH518L|6 1ɺH5vf.ATUHSH dH%(HD$1IL HtrH}PaAÅt;LHÅtuHL$dH3 %(H []A\ÐL5 1ɺ1H5_DL5 1ɺH515Ly5 1ɺ1H5jDSt$t [DL'5 11ɺrH5D轲[fSt$t [DL4 11ɺ;H5m[fAWAVIAUATUHS1Hxt$H5IL=1QHT$11H`D$L}$ 1ɺ@D$Le$ 1ɺ2fHCPH8YIHHHEHtXE;gLL$ 1ɺ1H5,襡11LHH$H@@*T$1LH D$L# 1ɺDD$L}# 1ɺHm(H蕻HLIUL@# 1ɺQH5ZؠE1HL\$C LwIH5%1蜠AGLHL$(LHT$ pXL\$HL\$!H $HDh8HH$L$L$HPH$AoL1HL\$LҵHD$ HxH\zHD$(HxHFdHD$(Le(HHhX"HD$ HhX!AGL7H5(QI 1ATL荟AGL^_Ht$ LH2t!AGLHt$(LHL! 1ɺ1H5,D$Le! 1ɺLR! 1ɺ9D$L;! 1ɺnqD$L$! 1ɺZL! 1ɺ{D$L 1ɺk0L 1ɺH5lL 1ɺ1H5YFD$L 1ɺL 1ɺH5 $@AWAVAUATAUHSHHDl$HDt$PL|$XQEDHHLL|$HHADt$@H[]A\A]A^A_ff.f.wAWAVAUATAUHSHHDl$HDt$PL|$XEDHHLL|$HHADt$@H[]A\A]A^A_f.HLq1ɺ IH5^1t}AD$Lif.1L{ H5^<}[]A\A]A^Ð諗L' IH5^1}[]A\A]A^fL)1 H5S^|[L 1ɺ 1H5&^|.f.HLч1ɺ IH5]1d|ff.@AWAVAUATUHSHH_XLoPHwHI}Z IHfH5|_HpHLLIH HpI}1H+lAąMvLPL\HE1HTRH @HH9tH9luHL|HH9uMI}L.AąI}HHAąIFXL%H EXH"HEXAąLsHIhHp1IمL͇H5C\@H11ATAzXZ5fD LIH5[1E1qzHD[]A\A]A^A_HД LIf.L訔L IH5[1zLA 1ɺ 1H5^[yafHH L/I(L 1ɺ 1H5[yfLG IH5Z1TyLE1轓HH貓HH5ZSIL 1yY^LA 1ɺ1H5^ZxafAWAVEAUATIUHSHH$T$L$8DD$HD$0dH%(H$1LHË@L$D$ %HCHt$HP 6 DAͅ)Eu C8$HU<$@$D$u#D$uID$PH8qnHUD$HsL{H~@IGPHHD$(H(HM(n7HU(LHT$@H1ɿHT$HI1LH5XRcwLSAYA[IB HHEHE1{LHHFH|$(.IH H9tvHD$@HP(HHCHT$(HxPYHT$(LM(1LxH5>XRlP1vLM(Yn^L|1ɿH5 X1vLT$@EHCLD+xE1HsLH{HAHDxAv&Au H[HHNTDkLf.Et A $t9$t A LCL}(HULMHIp(LD$@LLL$(4l ELL$(LD$@CLAPAm9eB]D,$A]CL$<$@WA@1E1LH5V5uL~ 11jH5VuKL@u9)AEf{LHHAw?IOPH HL$(fDLm(HtHLlHLm(UH{HAULUI1H5U?tXZLufAD)D9t-H{蘎Li1ɺIH5}U1sHCLHAu3Et.H{ULv1ɺIH5:U1sD\$E2Hu(H=sLsHULI~Iv(iI93A>LDHCH@PLHHxʍ IHH9kHiLWLLDL X1LH H&` VHM(H{HL$(\HIHL$(LLH1 pH$dH3%(DH[]A\A]A^A_fHu(H= €t `~E1@H{%f.HUƀ{L/ u u uE1]H$HD$(HT$(H$L D$E-HSDsLHBRu A9 A)֩u C8$LlPLH@HpH'E1AH}H'}1<$@DHHPHH>7L,HcI9H$I9H9ku$ L-AADž Et|$Ha tH](LHLI诈S1AWI1LxSH5OnXIt$X6fL 1ɺg1H5JOiL 1ɺ1H5J.iftA8Hu(H= HI{Lk AAvEzEH{LT$(*HHAWH5JUILv1uhY^LT$(fLL DI HHcхbƍHHtQ@LσǍHHI HHcхuA{L@H{A7HHHLuUI1H5IgHk_AXHD$ A;D$A;AFLUAu9v)D96MFMH-4HHLEAHH5NHu[HHLHtHH"H4H3HE1IHDy@1ɺE1L H5Gff#L 1ɺ1H5G?ff.Ly 1ɺH5Gf$MfH$H@HHD$ H$Hx2Lv IH5G1eFfDL 1ɺ H5FaeL 1ɺ 1H5F;eELjJ1D H5F eĀE6{LqH{SHHL9sWARIUH5$F1d_AXILI1 H5Etd2H{~HH;HLrIU덩 Hu(H=6tHE E1Lw~L[ IH5YE1c1A@L qH5(EcL 11 H5Ec;L 1ɺ 1H5DZcL}LZIH5D1&c,0AHCH@A ^H#E1HHEH $|$ ; |$9A9I89$LHt$ht>L}H ILs, H5C11Ub|$hG1111LJ|+AAu A  CLA EzD)A9 EH{^|HHD$@AWHT$HIH5:C1RLo,aXZL 1ɺ 1H5Bwa5HE1M$t$L轂AAF89$D$A;sL{ H5BAPI1SLF`AYAZf.D$d9t5LA)M{H$DL$dLrHSD+JAV_ PMH$H89$ID$P$H8 }LHD$PzH<$HD$H@HD$@H$p8ID$PH8|HD$ Ͷ1H5A@H1HL$XQHT$X1RLD$Xk APLL$@Lor_H LA9WOfDŽ$HHD$ H@)$)$HPt AHD$ HT$xLH8L$@HL$|k4  HD$ H9ht)L\tH5@117_ID$PHL$(E11ALH8'tu11n.HL$pDLp,HD$ P(HpՋFHFu9)F)l$pA$HFu A9D)Љ|$p)1HHL$HHHHʼnHD$(ID$PHH8zHL$HHD$PID$PH8HzLHD$Hx$H5TL "RHT$XLDLAsH5w?RHL$XQ1P1]H 11LhsH511X]LwE1ɺWLsH5>P1*]AXAY|$8 |$u6LwH|$ HDHH=Rt)H16LLDʃELL$Akt |H5W;ASLrPLL$(1YXZDHL$01L.>HkIl$XH[]A\A]ùSI$L]H5p[H@LHH1>H[]A\A]L 1ɺe1H51[1>H[]A\A]tH{P.H[]A\A]@O,LX L3]`IH5Z1>HML$HLKb1xH5qZ=fLKH?1LY\H5BZ=HXL[:IH5 Z1a=_@L 1ɺoDLKHj1Lq\H5Y=H{P f.SHHCX@L Y t21L]H5XY<1[f.HHCXtHL [uHHt H0 HHt H$HHuaHHt H H [DL X"@L @L X@H1L XLO[1ɺ1H5GX;Lv[11H5&X|;1L[1ɺH5X[;[@L 6fEI1L2H5`c 6@L`HDhEH0 L /@KPH71PE1LWH5b5XZBfDH؏ L E@LW1<H5bT5HHD$r Ht$M[L @UHSH8dH%(HD$(1G\ HP :Hj¸HHH9u |HH9tqHCHxcjtHCHxOLWIH5a1k4'@HEPE1E1HHH8SIuO1Ht$(dH34%(uIH8[]fDNLWVIH5Ma131볋$1+ff.@ATUSHG\ to(Iċu=t1ۅÉ[]A\DCt/ID$Ht%H@ H@XHtHKPHu=1H9ЉÅtHu=M1۹LUI1H5t`"3[]A\LLLIH5B`12@@HH HP @x}=@x}NиH)AWAVAUATUSHH8dH%(HD$(1HGH@PL HD$ H{ALHH{HT$ aaYHT$ HBp8D@0 ȉ ȃD Ai@BO9jBD99HBHH90HHŒ uHT$ HBHHH;tqHH-'薌 H{LH_HDHD$ E1H@L KHK1UILTUAUH5c^1AT 1HT$@H H:lJ H\$(dH3%(D>H8[]A\A]A^A_fDH0'EL4^LDH A^@HDH?^@HDL==^LD$LD@H{HL$L54^HT$LDJHLD$ IH5]1APHL$ LSQHT$ 1RAWAVE1'0HT$PH0HB@8*LE1[KLIHD$ pHKH{H\JAU1ɺ?UILS1H5 ]/HT$0XYfDLJLIHD$ pJH{IIAV61AUIH5\1LRE1K/HT$0^_B@LJLIHD$ p{JH{IIAWLR1AVI*H5;\1E1.HT$0AXAY fDAL 11H5\.&fAWAVAUATUHSH8HGPHWXHH$HL$@H%HD$1HD$ LHAdE1D$,I9I ILgX5H|$HsID$H|$HTDL$IWE9ELA9DOH;T$t=HHHD$,HL$ H9tfHpHHvHH9uHEPM?HI9JH;\$ HL=Q2H9HH-[HD$,H L%z#H|$HHT$IULQ1AWHT$ IH5+Z1RAT,H AcEH8[]A\A]A^A_H|$HD$1HHL$ HHHH9tf.HPHHRHH9uH9\$ sHEPf蛭HHD$HuHD$ HEP1葂1L(QH57Y@11+Ac~5_1LNQH5Y@11+E*1LQH5X@11s+H}P0H9sWHu,L=!H-$Y#H|$L%!EH$L=OHkH|$HGHAc EGHD$ L=U!fAVAUATUSHoTH9r%1HHuA[]DA\A]A^fHHI@AąuIEPHH8GIIIEPH8FH{HDLHDHLPAVI1UH5rWS*H D[]A\A]A^f.UHSH^HHt&HΑHHtNHXHH[]H8DLWIH5V1)Lѫ 1ɺ1H5Vg)DSHWHGBHHH91HJH9BH9uXw.A1 LWH5>V([11LVH5V([fDH1&CLOIH5U1([`ff.AUATUSHH8dH%(HD$(1G\ A蘩HL fE ~A9zH]E1HNHH?HH9t\}tHmHCPHE1E1HH8L' 1ɺVH@?LL IH5Q1$@DvLѦ 11,H5Qg$fH1>Lt@IH5Q1/$f.H>LLL<IH5JQ1#@HCPHH8蹍ATIHIUHSuHthH5C HH>t2H5QH+ugA$E[]A\fDA$[E]A\1LKH5kP#11IٹLKH5@P"1DSHHF҃H[%Hff.1HvAStA?LP1ɺIH5O1["[LIK1ɺH5{O)"[fUHSHH5ϑHHuEH[]f.H58HuEH[]f.H5j=HQuEH[]f.1IٹcLJH5NY!1afH%8tPHtDH<t8H1tLqJH5WN!H|H@ff.@Ht1G\tHLL9uDHt+HL9tHJH9yXtHL9uf.G\u1HǡHHt!HzXt HfDHu1HATUSHHHdH%(HD$1HGPH8H$ HHOŅH$HPH8H*%9 HHH9HL :LuIATI1UH5L1]XZHL$dH3 %( H[]A\@H9LHIH5bL1 H߉v9LjIH5(L1of.;9L I1ɺIH5K1HCPHH8hŅtH8LHIH5K1AGAUVATUHSHwukH[]A\A]D ~:HIn:HIa:AUH5KATILgH1Y1^tHﾀ :HI:HL[HATI1H5JVXZ1H[]A\A]AWAVEAUEATIUSHHXH$T$ HL$8H$H$H$L$HD$0H$HD$H$HD$ H$HD$(dH%(HD$H1E^AHD$ HD$(HT$LHHD$H$EDd$ LA1J4H|$IHHHD$@H9JD 1IIHD$@HHt$LL$@HL$ t$LD$P苐AZA[oLl$HT$@HML|$A7I I1HALLIL9*8uHI8Ir1M7LGH5H@H11AWTu_HAXMuL9HD$ HD$( H$Hߋ0I7LV1ɺUIH5*H1AH\$HdH3%(DHX[]A\A]A^A_DDd$ L1IIHL$@HHA%Dm= HFEEA9 H6LE1ɺIH5`G1D}fDPILE1H5 GE1 )ADmEOuH6LG1ɺIH5F1_D}CfDHKSHLKHEoHD$ yLHHH`LHHHH|$ H2$L 1ɺU@LGHHLGHHT$($L 1ɺ,H5E1LD $xE1H4HHAt )v = GƉH`4LYC1ɺ IH5E1HD$@D}xfDH5SHib$LǙ 1ɺD uRH31LCOIH5D1-H߾3LD1ɺQIH5UD1Lt$(1L hE1LhEIAH5DA@;3uHI-3HLBATI2H5C1pYE1^fDLHLH'Dd$ Lu1IH<HHHD$@H=v*v w HH=wMHD$@Hy2L1ɺIH5C1HD$@D}$L 1ɺ:;f.H2HLPHD$H>LH(@%jL@H5B.E1[fD$Lf 1ɺ DHH 1H@AWAVIAUI1ATUSHHdH%(H$x1H|$PH|$HHCPH8HHD$PHCPHHx薬H%IMIH=HD$AH$AFADT$4HCPH H8҃A)0H1ɺATI1LBH5AGLD$1YHQG^DᾀILLD$ LD$DT$EbAN IcMcLDPMIND AF=o=v =ɃKL1LD$HGu LD$XIcA~;AL$LDPtCLcHFLHH1H1 LJ 1ɺ!1JlPAL$HCP1ҾL$H8L$HH@ Hu6HP:t HcHTPH@H8tLA0H5E11SH$xdH3%(HĈ[]A\A]A^A_H$H龀1LHcEL( LA 1ɺx,Ld$XAHD$DL 1ɺH5E11MHL$l HcL$HD$@L|PHt$1HHD$HCPH$pL=mAH8CIHLt$8-f. HHt$pL uLH]H\I}u1LLHuHD$8H4HCPIuH8;-HK1PLL$H1L@H5CXZIfL1L\$(HCLL$ DT$LD$v LD$DT$LL$ L\$(AFNDPEbN = LǾLD$HC1 LD$L& 1ɺf.H8*L\?:IH5B19@H|$GŅI}L?YfDH)L=IH5sB11fIL 11PH5DBL) 1ɺDL=1)H5ALL 1ɺ LL$PL]B1TH5Ac LL$PAL8>Nff.AVAUATUSHH $HPIIIdH%(H$H1H\$@A MAHHA1H 91H1ŅII?LqA$HL11'A<$IEAH$HdH3 %(DHP[]A\A]A^@ MMHH'A1H, <1H1AIą+8E1I1PH0L PH5?1 _AXEL@1ɺH5?1E1l A<$I1PH2LE PH5?1* XZA<$I1ɺPH' L PH5D?1E1 Y^I1ɺPH?L PL?1ɺ#SHnt0H?t$AL*<11 H5>` H[ff.H@HcH>HQHW?HN?HF?H?HHLHA11L;7H5= HHff.SHt;H>t0H>t$ALf;11FH5=4 H[ff.@H xt`H tUHe>tIH_>t=HA11L+;WH5= H_ Hfff.@HG`H@PH‹\HHwHHH9t"1HHHQ$H9u9`s`ff.fAWMAVAUIATIHUHSHH(H $dH%(H$1Ih Ah(HKPHSHLHH HtbHT$LLIHT$S tvH$xIGH$dH3%(+H([]A\A]A^A_fH"L9麽IH5~;1$1H"Ht$I1L9H5D;X1ZhH$IOHK<Lp>H$IOH9LptH$Hp Hx IwAG HI+ HAG$׈HSP`HIGH< AG(D@AWAVMAUIH5,ATIUSHH8L$ dH%(HD$(1HGPHHD$ HHD$脽HA4$IHHƃ<Ht$ LS |$ 3[FL81ɺ1H59]HCPHH8.pHL$ K6H)HHL$ H91H|$H :HH1A$:HHHfAoELxAoM,AoU <Ao]0D\LA$`HKX@HmX?HL$(dH3 %(HH8[]A\A]A^A_fHC6HHt$ HH581L9I1,A4$HHD$ H)H1HHCPA4$HH8r!HD$h[1LL$H58L6@11A4$A $HCPHH8!Ht$ HHCPH8!HLq7UI1H571CXZ@HT$ LHHHLo6I~fL61H547CL 1ɺ1H57 f.HL6IH5611of.L 1ɺ1H56?f.Ly 1ɺy1H5g61 iUHSHH5pHHuEH[]f.H5 7HauEH[]f.H56H1t%H5~ Hu*E@EH[]D1IٹL6H5q51AfAUIHATIUHSHMHiLNHC8SLOHC9=LPHC:'LQH LRHCLSHCLTHC LUHC;CLVHCLWHCLXHCLYHC wLZHC$dL[HC(QL\HC,>L]HC0+L_HC4^HLCUH{uHLJÐSHH HHHt[D1L$pH52&$1[UH HSHHHHHDH6 HHHt H[]1Iٹ}L&H5%1ff.fUHSHy HHHE`H%HwHHೃzCtHHൃxCtགྷpC}PHC9tCcHH[]fDHȩ຃sCHH[]L1H5$f.AWAAVIHAUATUHSHHZlL%Ht)H{@HtIE Aąt"1LLt$0$dE1E11HIEPLH8HvDL$0EhHL!D$HH5!PDL$L1KHD$8DL$L_AXHP0D$@rJA9uu9uq1L!H5!RP1HD$8A_YHP0:AHMXAl$LD$I}P1`hHD$(HQLVH5!P1HD$HH eI$LH5 HD1LHH1FHD$($L$#@L_ 1ɺH5H1[]LY_ 1ɺH5eL1_ 1ɺH5=ATL1ɺ.UH5H1SDOLDMP11L/H5kHHt%LHHL111H5:11L9H5 1HH:11L;H5R}Lv(L%LH9]Lw[L]1ɺ>H51A\fDHEH@PH8L1ɺ6IH51LATIUHSHHt\LHHcÅt]HjLH軭Åt[]A\f1LH55[]A\D1L\ 1ɺH5[]A\AVAUATUHSHHĀdH%(HD$x1t=t7Htz=HL$xdH3 %(H[]A\A]A^DLt$Ll$ HLd$MM1=LH5C=tLLH='Ll|$aD$ t=JHl$ PHO01HL$HT$HLD$H5C" W|$|$|$t7UHSH HHtHHH[]ÐLA1H5Ef.AWAVAUMATUHSHH(dH%(HD$1H?L|$`Lt$hHT$LH AątrHD$HPIHIHxH0MtAEP1HHAæ Ht$HAE HL$dH3 %(Du[H([]A\A]A^A_LAZ 1ɺ1H5PDIHHLL$LL$I$.f.AWIAVIAUIATUSLH(AhLH1Ld$`LT$hHT$pHHC0% HLCKPIxP9DAK E_LT$Ht$0Ht$SPLH AIHCAH@PLT$AuAL Y 1ɺyH51E1RDELL =HH=L1H0;E1IHDT$',DT$C1 u,j=AtDT$ ,DT$wAEAL1DLB E1AdDL$LX 1ɺbLCIxPHucE1AMHHLD\$LL1D\$H(ALHL[D]A\A]A^A_f1KP9AE1۽sHsHhLFY HEH9AIHHC$LLHHH5?1E1@LLHL$HT$LT$~HL$HHH{LLT$HT$D$LV 1ɺiH51KDL$H(D[]A\A]A^A_@D$LuV 1ɺ|@^=C1 Lq1oH5ME1LV 1ɺJDHL@LHHH{Lp1ɺ1IHCH5H@PH1灁DŽBHCH@PHDT$.fDUHH5HSH^ t H[]fHa LEIH5:1H[]fDUHHSHdHHtlHO8HHCHC HHC(Q HC0HtHKLK(L 11H5+HH[]ÐLiT 1ɺ 1H5xf.AAIL9sWHH H3xDB3H-<8IBHL PHt PL 1H5UIH |$輺uA<$HL mPHL PH51UH *H= 1衿A)HA15=1DCAƃ$DH-b|$;(L AQL PHPHPH51,H ;8ھATDzPH L 2PHL PH51H L#L 1ɺ1H5돿-;^L APL PHPH&P1;)UH-ȿPHIPLݟ U1H52H D覸D;׽L wL ARPH. PU|$ 肷|$ PI<$HL#;lM $H HJL* A9HDQPHq PR4;H-Ѿ%IDASL PH PU;L ~ L VPHPHāP;ǼL C L WPH PHPf.SHHH?dH%(HD$1u@{1Ht$I9CT$1HL$dH3 %(H[þ8HL PHy Lԝ PHH5 P1H kk8ĻHL [PHD L| PH5 1AQH 1:ʾf.AWfAIAVI1AUATIUHSHHdH%(H$81f|$.LLl$0D$fDL$HD$"D$*蒽蛸L$Lyw?/諼HHuCD$HD$HD$ 9\$HLH 1SDL$MLH ZYH1pA$xHT$Ǿ1蕻EA<$t˼8$}IH HHEHPHL› PH5 1RGH 9\$%1H$8dH3 %(HH[]A\A]A^A_DLW 19H5 18\HL H5l P+He L P1AQbmeD$ZHnohostnaHD$Pft$XH 809fATIUSHHdH%(H$1蓷HH޿+ŅH|$uAHqH$dH3 %(RHĠ[]A\Hg1IATL H5G [XZ諺18IH5 PLl ]1ATY^]k8ķ;IٿH YH|HDH1PH Ld PH51RbH 8\;IٿH H3|HDHL PHX H5BP1RlRH T@HdH%(H$1?tHH]H$dH3 %(uHĨS1HdH%(H$1?u"H$dH3 %(u6HĠ[@HHغxʋD$1%=@zf.USHѸHHH]u[H؋H!ʁ t€DHHHD@HDH8/tH9rH91H1袵ŃGt8 uHH[]~fD8<;H ٶHzHDHIٹPHL PRH512H HH[]۴;IH pHyHDHL PHi H5P1RѿH F"1fH1[LH5s]醿fD۶84;H ѵHyHDHIىPHc Lޕ PR.HCKff.AV1fAUAATAUHSH0dH%(HD$(1D$HD$D$fL$f4$MHG/HH脲HtH H߅!脱fAAIH HRHEL1ɺH5=P1SXBZH1 Åx?H16HL$(dH3 %(H0[]A\A]A^S8Eu; 2蕲}IH )HkwHDHL> PH H5uP1R腽H ^@cKĴL-ijL%w8I }LIIEHLʓ PHH5P1R H |A>謱}IMDHLk PH\H5P1AT豼H L> 1ɺ1H5s肼_L>1H5ET1Zf.U1ҹfSAH5LH8dH%(HD$(1fT$f $1D$HD$D$ػ1Hױtz;uHD$(dH3%(H8[]@8LHL PH L PH5B1AQRH @衲8HPL HPL H51AQH 8DSH t7:8u41IٹL:H5譺[fD[;IٿH H2tHDHL PHH5AP1RQH [fDoFhUIHL SH5/H8dH%(H$(1~t:SH$(dH3%(H8[]f.HHuH$޿uH$H9D$uH$H9$yHi螰81I5PHIO H5PLq 1 Y^)[8购8I1PHwLp PH51ǸXZ˰ff.AWAVAUATL%<USHL5<IM9xAHL-tyfMN1L1LcTOA~ AvI~I~L HHIL9HHtI~HuL EjAFLL%D$IFHD$I1覷|$i8I(1LPH L|o PLL$1^XZ+諮8MN1LPVH@PL-o 1Y^H1[]A\A]A^A_H[]A\A]A^A_@AWILAVAUAATIUSHH5HHdH%(H$811҃" P1TRRrq̭_AXIH$L|$HD$cfBL1 Elj轪A>… LLPE;xdtA>蘪1MuPH[H5PLm 1諵Y^T@{;2A>D$<$<$T$WL1H5NK;Ĥ11ɺLv7 H51H$8dH3 %(xHH[]A\A]A^A_f.HT$3_H$H9D$H$H9D$f.A>HM1PH Lvl PH5[1[XZ@A>A<$MH HmHDHL PH& H5P1RxH 1A>訨A<$MH ;H}mHDHLU PHH5P1R蜳;H M菫ff.@UHAWAVAAUIATASHH(dH%(HE1E8HHH@HH%H)HHH9tHH$H9uL|$HHHMIL誮HMHuLL:auxADt$At[uLpDLHH]dH3%(uTHe[A\A]A^A_]H)HLef.DLH]uLEE5D1cAWAAVAAUATUHSHA*AAt:1E1L&H5賱HD[]A\A]A^A_ÐD$ RA L$ DH<L-<DEL9uHL9LsHL]ADžuރ|$ MLH5 1Ƀ" PDl$1AU{D葥ZYWA)@H[]A\A]A^A_D$ WA L$  L2 1ɺHHHIHCHDt$ CLH5FA1Ƀ" RD$P1'^_H8Da<HsEDDHA11 EHH=7<" DH谢L 2 1ɺH51蟯E1HIL%H5cP1]AYAZ@L$ DHaAFfH{HLh1 11H5FfSHH=A< H1Ҿr[<D=,8D==D=Suu =[LI1ɺG1H5_y=[=b=D=N=D=:=D=&=D==D==D==D==D=J=D6=u=+8ff.==D=f+8D<u=<ff.=2+8DUfSH)=)=)<)<H=H<gH *8HK(AH=z<1 t]t)u%H(H5*8[H=<]釢 u<D.<D<D<D<D<Dv<Db<DN<D:<D(8D<D<D'8Db<D'8D=<D=<Dt 1=<'8Dv<D<D<D'8D '8D&8D<DHu<@H&8@H&8@H=&8@&8D=v&8DH H1HHHuff.@Ht'Ht"SHH1HH[H1f.f<ÐAW11AVAUATUSH8dH%(H$(1Ll$LL=&8L$1E1LLD$ ;ڜH{H %8;LH$<$HHHPHH)HT L膜3L-<NIcԃHkzHcHTAHAtc;1LA1Wt8͛L_ 1ɺ\PHH5PLK1ߦAXAYfDL$ H$(dH3%(H8[]A\A]A^A_3L莡D$ A۝84H5#1PH2Lc^ cPLK1F^_1L]|8՚lL 1PHL] PH51XZD38茚L ,1L] PWHrPH5X1蛥AZA[蝝ff.f<u <H12L;H5@n<HDV<ÐH$u9<0<~ HfDHAWAVAUATUSHdH%(H$13$<<<H1L="81H_Hc<ELEHc<EEE1L-p"8L%H-6\ HHcL<C<7HHP1It LIIufH$dH3%(HĘ[]A\A]A^A_5!8HRHc<Au_1H޿p6Ӛ8,1H5L :PHPLN[ 1;Y^@5B#8HҚ{8ԗOL5I1P1HATXZSHdH%(H$1<" <t$H$dH3%(HĐ[@HHu)H<H޿]ui<D賙8 HL 5PH<Lx PH[PH51 H O[8贖HL PHLlx PHx[PЙH3!u <uH1H5<}u<Hf.˘8$HL MPHLw PHZH5P1$H vff.S譕q [HUSH-.Ho HH H)!fHs+f.:H_t!HAu+4vϸH[]=H[]Df.Gt<.lb뵸뮸맸ff.H5SHH H!%tDHJHDщ@HHH)H5tgH5H H!%tDHJHDщ@HHH)H5g覐[HSHEfH9[ATUHSHBLHHݓHu=H I9uH5HHu(H5H謓HHHHEH[]A\Hf.UHSHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H3H$IH}HD$HD$ IH$D$0HD$oHc1xH rH9wH9tH)HUH H|$dH3<%(u H[]踕HtgU1SHtQHoߐH%t@HfHBu!>wHrH1[]H]u̸H[]1ff.fH3HfDHATUHSHI8HH]HՄtdHUYtI 1$@Is9fI|$A $2IHJt LHAxuҍy@4vL@L[]A\Dff.@SHCHuNHIMu [Ly1H51[ILf.SHHt [DHh1[H‰ff.ATUHSHLHH%HuH L9u[]A\f[]A\fDUHSHHHt+HHH5>S H& HHt.HH[]@HHT$HT$tJHi 붐H8LdIH51葚HH[]HHT$cuHHEXHH!H9tH.Ho9H/HD'H4HfH%rCH&HoH'HE@uHT$HHHHHt f.USHHXHt$(HT$0HL$8LD$@LL$HdH%(HD$1HD$p$HD$HD$ HD$H-f.ƒH$HHt.HH"Hu$/vHT$HBHD$HHuHL$dH3 %(uHX[]ATIԺUHS踎 tDH_觌HHt_MtHxL1ܐu E[]A\Lw11ɺ2H5}[]A\fD1ۉ[]A\SHL=H;Ht跎H[ff.USHH=H8Ht/貏HHtzH҈H߉訆H[]L 1<H5ė1L/1KH5螗H[]DL1AH5lf.USHH-G=H}tH[]f.H=?o 1RHuȉHEHtÅuH}kHE뮐L"H5Ζff.H=HÐ闊AT1IH=.UH1SRHLlj談H9u߻څ[]A\裍8HL PH> Ll |PHOH5OP1H qÅt11L0 1ɺ~H5ȕ[]A\Ð1ۋ8rHL 4PH L*l wPH6OH5P1rH []A\1L 1ɺH5?[]A\ATIUS)@L`1҉)9w[]A\ff.f1fH= HƅH(\(HHcHEHHHHÐAUATUSHdH%(H$1HtW>/HIHH8IHt^1IH) HLo tbHLztMDH$dH3%(uEHĨ[]A\A]1ҾMHI8HuDHHL蚉 ӋUHAWAVHAUATSHhL5<dH%(HE1E袊HL-<HHL9IIEHHH%H)HHH9tHH$H9ut H)HL_H\$HHJT+H9sf.HHH9wH1HxE)E) u EEKHxL=<DLIHcLMu.HxD;}LI>L=o<DKt=LHI9s@HHH9wL=:<H9<IEL11H5-ܑBIH<Ht'I$xH@I$IL9wtE1LfK|IrD9HEdH3%(uTHe[A\A]A^A_]辂IHd<Hx뙿蟂IHE<HY%DAWAVAUATAUSHHD<dH%(HD$81EtKHL$8dH3 %(sHH[]A\A]A^A_HHHE1H8L-H=c<HI9q=S<11HHB8E1Hu#HH8IL9vH5<=<L)L?HuH8L9pL-<1H߾CD5ZE\$H bHD$HJHDDd$HD$ L3IH`HL$0HT$(HLHD$,AH5 PHD$3PHD$:P1LL$ALD$@HH |$ rLcd$$H5MLHyH5nLH<H5ELɃHRH|$HD$Lx Mt2fDA?uI_;tHL膃HMMuHT$0HD$(H5LoII)L}ATL$+QL$2QL$9QjrRLHPIHIº,H PLL$P1%H@L$LH|$(_X{MnWHH8HHH<hf軆8gHL PHLd NPAQӄ8,L U<1LhE PhH51AUAAXAYI舄8= <H zHFHDHDPH L <PLc RmH5$11όH !8zHL PH L2c IPAQM1L1H5jD$]HAULL$ LH51.^_'Dd$HL z3 \$LEH57LEHu1ދXZL1ۺbH5賋艆8UA}H 9EHHEHMPHLa PR5H51IH D$8HI7L=H!7H9|L;HLLHtAULAWLL$ AULSLL$ {HAULPLL$ VHH89A}H DH̀HEHMPHk]L` PR0FfDSHKD *<P<L#H5CP<P<P1<H u<<t[D<1j~1L1ɺH5脉<tBl<1H7<HOuL 1ɺ%[H5;1ҾHIM<u=<u'H@"HH=<'v 1H=<1}<a,8}=<H H`BHDHL <PH PL_ H51RsH [Lh1[H5HATUSF<11HyÉ<tD%<D9R[]A\D}t|L? 1PHL 6~PH5 1軇_AX[]A\11D{u8HAٹATH5LuY^[]A\fD} |HE1P1LH57XZ[]A\Ë ><t0< "<tS <11>{tJU~8{HA1P1LH5ņXZ<[AٹLaH5苆[<ff.@SHHdH%(HD$1#VD V<PC<L?H5oP1<P2<P1D#<H Et < <t$HD$dH3%(H[f.1ɺ,H5 1LH$觅HHt3D <EtORH=<fx<sL 1ɺ/H5A=*<turH=< xH$H9<H<zLL <H$HLH9suH1RH5L0;辄Y^0|8kyL< 1PH*L ~<4PH51z_AXIH1RL*?H5IXZM|ff.fSIH.<uH H= t@L91uH5-܃<u<H[HLL$#QLL$1Lr<H5考HHfDv<SHt )tEIٹ1LpH5.4<~ '<[fIٹLiH5<<ff.@<D<D<SHDHD <AtQ1LKH5mH5s<t [f[ f.J<~L1H5cD <ufDD <SHEtLn}Y^u@@@H1&LH5t}1Hff.fH1&LH54}1Hff.fAWAVAUATUSHHHHj?t~IIAH0H{?tcHtADžuDt}oLLE1A$oKAL$oS AT$ S AHD[]A\A]A^A_f.IL1E1*H5V|@H/IPL1H5$|XZAWAVAUATUSHHHHj?tnIIAH0H{?tSHsADžuCtlDIT$HLE1HSS(AHD[]A\A]A^A_@IL"1E1EH5f{@IJ1L*H59{H1IROLH5{XZWf.SHH0mH[mfDHGHWE1E1Hp0HBPH8|ff.HGHWE1AHp0HBPH8IfHGIHWHHxPHr0HH?黴ff.AUH 7HATIUHSHdH%(H$1Ht$HHHD$HHD$Hd HD$ HHD$(HHD$0H HD$8H HD$@HD$XH@HD$`HHD$hH HD$pH HD$xHxHL$PH$ƈÅtz<t>Ht c<E^<H$dH3<%(WHĘ[]A\A]HL$LL$ LLD$H5$<蛌É<T$H\$L%Lkx9r6tdLK0M1H51HwxT$L9t9sʋC H <L9ut1 <H@C9D$wuC9D$ sfD$t uD$ uL ߕ 1ɺ=1LKH5wDL! 1ɺ)1H5woff.fAWI1LAVAUATIԺUHSHH5H(dH%(HD$1SwHT$LHw KHt$CL9F HHZ:E1DCLAD9HDE1E11H@Ll1IEPLH8܋ADžuL=L\IH51vHt$j1E1LH5avHDKLHD$H5rL@ P1,vHt$ Y_H轐 HL$dH3 %(D9H([]A\A]A^A_AL6 11H5uf.E1D$ /Ht$HF0B<(DuIL$XD$ AD9sL|HEE1E1KDm1H1L`ID$PLH8[ADžuL輏L IzHt$AUD$ AI|$P1Ht$AlHH5iHHff.AWfAVAUATUSLHH$@H|$L|$pLHD$dH%(H$1)D$0)D$@)D$P)D$`HI@@@-{L@ HCHh eHHBdH E11E1E1E1AIIH\$=fAAE@@u\Lt LHI Ń9KHHH@Xt LHH LuHE@Hu=E!@tL!11xH5> s_DAAbI1HT$,Lt D$,H{FMLIH511rD$E11E1E1HUHD$pHCPKLD$|)щL$xH@ uUHl$0foT$@foL$0D$$C@)$$CD)$$D$$C8H$HLL$H|$$Z ŅDCLHT$1HH|$8H$dH3<%(qH[]A\A]A^A_HCTLLHHf.HP CLD$|D$x;@H\$E1CHD$AfA@11Lr^H5p)L 1ɺ1H5pf t:CL$D$x9LHHeL+fDSAHCLDT$ HXHIL,SPH51lY^DT$ H$dH3%(DHĨ[]A\A]A^A_D$ HCLHXH\HLIS널IL1PH5m9lL*1H5IlE1JE1D9v)M{1L@ H5k룃H{v'AHG CP1sLCPCH{MV1L? H5pk2Mh1LH5xDkLMoH$L? MLDHAWLZ 1ɺsH5!jL6 1ɺcH5jb@UHSHHHGWLH@ 1H5BHHC@ tS8HC@t S< S@SDFSHt"H5HDuuH+>@1H5tHO7S8u0HCHI@HHDHHH[]@D1H56HuL 1ɺH5li1H5HL 1ɺH5W(i1H5HLP 1ɺH5hefD1H5H?L 1ɺH5׽h%fDL 1ɺH5hH1[]1H5HL 1ɺH5g8hfD1H5HL` 1ɺH5'grL9 1ɺH5gK@1H5 H'EL 1ɺH5g L 1ɺH5ig@ATL%eUHSwL1ۅAM1ɺ!H5V1 gHH L9]LwHHtcMLt\1L%fHH@HDHt)HpH(1AM1ɿH5ѻfXZ9]Lw[L\]1ɺ*H51A\sfSHH9t [L_1KH5V"f[ff.AWAVAUILATULSHHHdH%(HD$1HL|$PLt$Xmf H$HPIHPIHpHx64 AEHt#Haw̫UPHHHHHH4$HA HL$dH3 %(Du;H[]A\A]A^A_fDAL 11H5Pe%]DAUIH5=ATUHSHdH%(HD$1HT$$D$\HH5 HHAA t@tupD$$AAEHL$dH3 %(DH[]A\A]DHHL8IH5w1AdHE1 L>IH5<1dj \ff.SHSHt~LHIytn unD@L1EtAHA@1H @HBH H:uHRHRXHHH9uAuEAA9[f1[@HpLAEHE11E1҃tHD9th1AHRHNjAt׃uH@H@XutAtE빐H@AH@XuHIAfD[ÐAWL=AVIAUL-7ATMUSHlH1HHHD$OfDAG ML 1ɺH5nC15bHL ÅIM9twHZHH|Lh Lx(IGHHHSH$ sHjHBYHYH$H T$HC0HSCHTH[]A\A]A^A_fM1LJH5Ya4@L 1ɺ1H5c/af.HH HFHFff.HFff.HH HFHH HFHGPHFff.HGXHFff.HcGtHFff.HcGxHFff.GpH HFff.HH HFH HFHFff.HFff.HFff.HFff.HFff.G(HFff.@HFff.G(HFff.@GHHFff.@GLHFff.@G8H HFff.H HF1HFfDHHFff.HFff.HHFff.G HFff.@G$HFff.@GHFff.@GH HFff.SHWHHHHRPHzHC[fDSHWHHHHRPHzHC[fDSHWHHHHRPHz!HC[fDSHWHHHHRPHzHC[fDSHWHHHHRPHz!HC[fDSHWHHHHRPHzqHC[fDSHHC[SH#H HC[@SHH HC[@SHWHHHHRPHzHC[fDSHWHHHHRPHzaHC[fDSHHH HC[ff.SHǰHܶ HC[ff.@SHSH HC[@SHWHHHHRPHzHC[fDHHv?cHDSHbHC[fDSHsbH HC[@SHsbH HC[@SHaHC[fDSHcaHC[fDSHbHC[SH^HC[SHc_HC[fDSH_HC[fDSHHHC[fDSH]HC[SH]HC[SH3]HC[SH#^H HC[@SH]H HC[@SHHHHlHC[ff.SH\HC[SH]HC[SH\HC[SHsHC[fDSH#HC[fDSHHC[SHHHHHzrHC[SHH HC[@SHH HC[@SHH HC[@SHH HC[@SHSH HC[@SHHHHHzrHC[SHH HC[@SHHHHHzHC[SHHC[SHWPHHHHzHC[f.SHWHHHHRPHz!HC[fDHH1E1dH%(HD$1HGPHL$H83wtT$H|$dH3<%(uHMf.SHHHC[fDUHSHHdH%(HD$1HGXH0ruH-r^H%1HH6H$XH8_n HcHEHL$dH3 %(H[]H u@HHEuL 1ɺH5THfHCXIHh@L 1ɺH5>1TH90LSHHdH%(HD$1 uHT$dH3%(u!H[@Ht$HSttЋD$K@SHHHC[fDUHSHHdH%(HD$1k HCXH0rpH-H$H%1HHjH$XH8l HcHEHL$dH3 %(H[]@HH荀uL2 1ɺH5׮RH롐HH@Hԭ tHCX:1HH蓂IL 1ɺH5i\RH0H$L 1ɺH52%RH$J@SHH HC[fSHsHHC[fDSHHHC[fDSHWPHHHHzHC[f.SHWPHHHHzHC[f.SHWPHHHHz13HC[SHWPHHHHz1HC[SHWPHHHHzHC[f.SHWPHHHHzHC[f.SHHC[SHWPHHHHzHC[f.SHWPHHHHz%HC[f.SHWPHHHHzHC[f.SHWPHHHHzHC[f.SHWPHHHHzHC[f.SHWPHHHHzHC[f.SHWPHHHHzEHC[f.SHWPHHHHzeHC[f.SHWPHHHHzHC[f.SHWPHHHHzuHC[f.SHWPHHHHzHC[f.SHWPHHHHzEHC[f.SHHHdH%(HD$1HGPHH8rH$u1HSHL$dH3 %(uH[E@UHSHHdH%(HD$1H$uOCZu)1HEHT$dH3%(u?H[]HHH$Ht@ @HHH$JEf.UHSHHdH%(HD$1H$CuoH$CZuUHqHt"HY f.HHdH%(HD$1HHt98H6<HDHH$O HL$dH3 %(uHf.H<=fHHdH%(HD$1AaH:7HHD7H$ HL$dH3 %(uHL=ff.HHdH4%(Ht$1yHuHQPHHu7H57HHU;i Ht$dH34%(uHH$HHI X8taHHY IHHUV HtpHfH*HLL H[]A\A]@1LϽ 1ɺ H5g;H1[]A\A]f.LfR  H5.;1f.HڃfHH H*XTf1L H5t:H1[]A\A]ff.@AUMATIUHSHHHdH%(HD$1LHMHHH$fHT$dH3%(u H[]A\A]f2fDAUMATIUHSHHHdH%(HD$1NLHMHHH$HT$dH3%(u H[]A\A]1fDAUMATIUHSHHHdH%(HD$1.LHMHHH$HT$dH3%(u H[]A\A]1fDAUMATIUHSHHHdH%(HD$1nALHMHHH$HT$dH3%(u H[]A\A]1fDAUMATIUHSHHHdH%(HD$1ALHMHHH$HT$dH3%(u H[]A\A]0fDAVMAUIATIUHHSHHdH%(HD$1ɹH$HtC\tDHCPLHMHHLH$Ht$dH34%(u)H[]A\A]A^ÐHLp(v H@+HHH)/HIIdH%(HD$1HHtNHƹH=h€H-HDLHLH$ Ht$dH34%(uHH-j/f.AUMATIUHSHHHdH%(HD$1~LHMHHH$vHT$dH3%(u H[]A\A]v,fDAVMAUIATIUHHSHHdH%(HD$1t H}uAH衶H$LHMLHHT$dH3%(uH[]A\A]A^@H$+fAUMATIUHSHHHdH%(HD$1LHMHHH$fHT$dH3%(u H[]A\A]f+fDAUMATIUHSHHHy dH%(HD$1LHMHHH$HT$dH3%(u H[]A\A]*DAUMATIUHSHHHy dH%(HD$1譸LHMHHH$HT$dH3%(u H[]A\A]*DHHdH%(HD$1HHP8HH % HT$D$_ HL$dH3 %(uH%*DHHdH%(HD$1HHT$H@8H%D$ HL$dH3 %(uH)ff.fUHSHHH9dH%(HD$18HHHHH$ Ht$dH34%(uH[]j)f.UHSHH8H9dH%(HD$(1HL$ HtH8u,HD$ HHH\$(dH3%(u4H8[]ÐHLD$HT$HL$HL$HT$LD$t(ff.@HAHH@X@u tyHt-HHHH5& HfHQt ATIUHSH HYdH%(HD$1HCXHHutH0QHUHAPHKcHT$HHT$LK Ht$dH34%(|H []A\fD?HtH`H-tHCXH H)HTrH%t@HZd@t;AHt҃HAPHuH84fH`%H%sAHtuCHIPH}JA8HA0HR NfDH57H$H H|R  @Ht$HUH|$H`6&fDATUSHHdH%(HD$1A\tIHHL*Uu6HH5?$HP Ht$dH34%(uH[]A\fLHH %ff.AWAVAUATUSHH $IHHHD2HD$Pf.HI1LH2 Lf H4$LLŅHH9\$tjL3HkLHILMlLpG IHuL! 1ɺH5Q11,H[]A\A]A^A_@fLٮ 1ɺLɮ 1ɺ1H5_,ff.fUHSHHdH%(HD$1AHt8t3D$HHT$H[ Ht$dH34%(uH[]@HSD$#U1HSHHHdH%(HD$1HHT$H߉D$ Ht$dH34%(uH[]#fDf.AUIATIUSH(HYdH%(HD$1D$HCXuH0sFHHl$|D$LHLJ Ht$dH34%(H([]A\A]H-t6Ht,H s,HH@H@ HCX DH ryH1Hl$qHCPE11HHH8KR|$GH&D$6fDHHL$W HL$HCXDHHL$sHL$H@H@ HCX'Hl$HHL!fDH֋QtA yH HQ ff.@H֋QtAyHx HQ ff.@HH HHdH%(HD$1HT$D$d HL$dH3 %(uH f.AUATIUHSHHdH%(HD$1HAXH$u~H r?HH5H HL$dH3 %(unH[]A\A]fH蘟tHCPIHLH8ϢtLHL HAPIHLH8胠uHCX` ATHIUHSHHdH%(HD$1H$ CZu=1H5H, HL$dH3 %(H[]A\f.HHH$HttH1H fHHH$H53 L4 H5y&18f.USHH(dH%(HD$1A\tHHt$HNu11H5H H\$dH3%(u'H([]@HD$HT$HHHD$ WAVMAUIATIUHSHHdH%(HD$1HAXH0rnH%rH-s@H落HMHLLH$HT$dH3%(uNH[]A\A]A^HH5H" HH@^uHCXtDAWIHAVMAUATIUHSHHdH%(HD$1臨HH@LhHLHHXHB IHL ]H G1MH[HL LHB HHLL. HT$dH3%(H[]A\A]A^A_fDHLkHupAtfL^HHXH?B IHtgL H E@L 1H5 $1\DHLLL,$~ @fL: DLZH59#1f.HH֋QLdH%(HD$1BLAO@OA8MXIMMCXu iAO@OA8uM@MPXt ЍPwHQ+BD$B t 1D$HT$4 Ht$dH34%(uHff.@AUIATIU(SH@ HHt,HӷLkHvLc HHCHH[]A\A]ÐL1H5ԇ<"f.AWAVMAUALATI1UHSLHL@ƃMHtHJ31DHI4HHt,LL!| HL| H[]A\A]A^A_fH1[]A\A]A^A_ff.@AWIAVE1AUIATIUSHHHYILAƃILDI)HD$, t LT$1A::tIH[]A\A]A^A_IZHIDILLI)HD$+tLT$A::tIZ1uIZH1IغILLHI)`^H]Pf.LAHuL@SH {1HH) w I؅xL[L1H5 E1ff.@AWAVAUATIUSHH(H4$H5مdH%(H$1 HH H<$L$4: HH0HE1y H$IH$H$HD$E>EIHPAfA9AWՃA:LfEgAL)H<$LHI>H>HH*y H$LH$"IH$E>EOA L;L9dHl$L f. HmH9HEuHHL=7E1y Lu LmH52HD$HHE@HHt$Ht$I9tAt$HPI9uA|suHL/IIwAHuM1LH5?H<$H198 H$dH3%(H H([]A\A]A^A_DHDHHx HHP !t(#tuH HHH HHH HHLfE1ɀ8:fDHt$H<$H7L$JfMcH7KdHDHEP w/HL$Ht%HA8HH HHHE@L3Hl$I9AA-LD$-D$-?fDAt%I΃A9DBA9DGHmH9HM9uHHkw HHI}w IHtHHjw IN / (MtIE/ HHEHVfD;D$HmD$H9fDHHl$H9E1E1D\$=A9t E9E)E1 AHH9HPJAAut܃A9E#E1ɃAf.|$9FljD$DHM Ht Hp>ZHHHEH%DD.DtLT$fET$VI1A-L$L H} LH^HEHf.H<$7 IHFH.LH5H L@LY11H5~BH<$13 fD$-A-D$-f.Ht$0HfoD$0foL$@foT$PHD$`L3)$)$)D$pH$HDŽ$DŽ$L9G1A1D|$]AD$ AD$HcL$HH)HH4H)H9HHOHiҀQHՐILH9IIFD AD$vAD$у w$f.kI~ 1I AAAIIALEpAD$vFAA XA NH gJcH>DHQAHD$@HD$pAD$x-l$D$|D|$A)|A*gD$#-!H|$pH)|$#HD$ HD$(H$H|$ H9$t Hl$ H|$(H$Hl$(Ld$ H<$HH$ 1 1ILH`| H vH<$Hz3 HHL1H5{ lDH9H wjH HMH HHHMLML)H5K{fDDŽ$D$|H !HMH HHHMDD$x H|$pD$pNH)HD$ H;HD$(jD$D`ك-,AnH|$p H)|$!HD$ HD$(H=HD$ HHB8Dl$xuH*LIHLH?HH)Ћ$)H@H$H)Ƌ$HHcH9~  $)AH HBP @HIiŀ: HIiŀQHD)$LHL)HlDl$tLDl$pIiHLHL1H5@yHD$(H LHLń1H5x`LɄ1H5x4HD$pH|$pH)HD$ H/fLHL1H5px,Lg1H5Gx1Ld H5x~Lǔ 1ɺ1H5w]L1H5w,f.LHL1H5wLH|$pD$xHD$pH)HHD$ HD$(A)t{A-HQHL$(H|$pD$xHD$pH)HD$ HD$(AHQHD$(1;|$#uH-HD$ y$$Lct;H7BtHcHiQHDHD$(;AE D$xHcuHdHHHuHHHHtH<$HJ+ DUSH(dH%(HD$1IMHL˅t|t"Ht$dH34%(H([]1HL$HT$LH5.v%uHH* HtxHT$HHT$HPHLHy1Lʁ6H5LuH1DfD4L;H5utH1qHu;HH HHEH HDH HHWHHHDH5,H'HDm HHq`HLH'HHH[ff.HHLHh7H,ff.HHLHx7Hff.fHHLH7Hff.HqXHLHgGHHff.HqXHLHsH*off.@HqXHH7LH?ff.@HqXHH7LHff.@HqXHLHHff.@HAXHH r1ĀtHHHHr7Lf.UHLSHHX1HH߅HW7@H[]XUHLSHHx1HH߅H7@H[]UHLSHHH7HHH H[]HƃfDUHLSHHHH7HHHH[]HƃUHLSHHH7HHHH[]HƃVfDULSHHHy@wH7HHH[]ff.UHLSHH討HHHH[]ff.ATHMUHSHu t9C[u1H7[LH]A\HuHuC\tHfH@ATMUHSHAXHH"r4u1H7[LH]A\DH舧@HuHL1@fHH%H5 Hff.@SHHHAH@H)r5H*rHH[@WH7HLH[RfHLD$Hx LD$HH@H@fSHHHAH@H)r5H*rHH[!VHr7HLH[fHLD$Hx苊LD$HH@H@fSHHHAH@H)r5H*rHH[UH27HLH[RfHLD$Hx LD$HH@H@fSHHHAH@H)r5H*rHH[!TH7HLH[fHLD$Hx苉LD$HH@H@fHHuH5` HfDH597D Hf.SHHHAH@u?uHHL[D1H7H@HL[@HLD$跈LD$HH@H@DUHLSHHxx$H7HHH[]f.HHH[]ff.@yHHt LHAPHݺ7Lp@;ff.yHHt L{HAPHݺ7Lp@f.HAHH@XH%syHtH0syHt7LHAPH7Lp8@f.HAPHշ7L@off.@AHׅuLf.qHF7L.ff.AHׅuLjf.q,Hf7Lff.AHׅuL*f.q(H7Lff.AHׅuLf.qH7Lnff.HHAXHH%sJH3r#H57Hj HfDH57HJ HH57H HUHSHHdH%(HD$1HAH@H)raH*r:H5#7HcHt Ht$dH34%(uLH[]XHHHH$C HHxHH@H@ff.UHSHHdH%(HD$1HAH@ t{HG^t&HPHt,HHHH$ 3fD@u膄HHuH57HgHx Ht$dH34%(uH[]@@tHPHuHHH5) Hff.@UHSHHHAH@H)r1H*sHHH[H4] fHH[]DHHx蠃HH@H@UHSHHHAH@H)r1H*sHHH[HP]2 fHH[]fHHx0HH@H@UHSHHHAH@H)r1H*sHHH[HL] fHH[]fHHxHH@H@UHSHHHAH@H)r1H*sHHH[HH]R fHH[]2fHHxPHH@H@UHSHHHAH@H)r1H*sHHH[HD] fHH[]fHHxHH@H@UHSHHHAH@H)r1H*sHHH[H@]r fHH[]RfHHxpHH@H@UHSHHHAH@H)r1H*sHHH[H<] fHH[]fHHxHH@H@UHSHHHAH@H)r1H*sHHH[H8] fHH[]rfHHx萀HH@H@UHSHHHAH@H)r1H*sHHH[H$]" fHH[]fHHx HH@H@HAH@uHWHĿ @HօuH'H锿 @HATUHSHAXtIHH@Du HHH5fz []A\HX[HL]HPDA\% DHATUHSHAXtIHH@@u HHH5 []A\H~[HL]HP@A\鵾 DHATUHSHAXtIHH~@ u7H}H5HLY HT$dH3%(u/HyHuHAXLHH@HH$臬SHHHHtHH1 [@Lj 1ɺH5MA1[ff.fSHHHeHtHH1苬 [@LIj 1ɺH5tM1[ff.fH1H5*> H@HIHtHgHff.SHyXHt)HHhHt1HH1ԫ [DH1H5跫 [ùLjM H5L1[f.SHyPHt)HHFhHt1HH1T [DH1H5#7 [ùLL H5!L1[f.SHHH]kHtHH1۪ [@Lh 1ɺH5K11[ff.fUHSHHHy dH%(HD$1Ht72HT$HHD$. Ht$dH34%(u+H[]HzH5H* ff.SHHH轇HtHH1 [@Lg 1ɺH5JA1[ff.fUHSHHdH%(HD$1HAH@X@uA u:HyH5SHd Ht$dH34%(u5H[]yHuHAXx^HHHH$, DUHSHHdH%(HD$1HAH@X@uA u:HSyH5HĨ Ht$dH34%(u5H[]yHuHAXxnHHHH$茣 DUHSHHdH%(HD$1HAH@X@uA u:HxH5H$ Ht$dH34%(u5H[]yHuHAXxHHHH$ eDSHHHiHt@8u#H5l7HH蝧 [fDHH1胧 [@LAe 1ɺ H5lH1[DULSHH;tH7HH1H[]=DHHH[]AWAVMAUIATIUSH8dH%(HD$(1yHtOH\$H< HLLIG= Ht$(dH34%(uH8[]A\A]A^A_f.H= H HHHL{PHHIWxAwpHH%tQIAHHIGHLL苡 HD$ D$ 9fDLc 1ɺH5FA1Lc 1ɺH5F 1@1L_c 1ɺH5F1L9c 1ɺ1H5gFDLc 1ɺH5HG7HH߉[]A\fDHH[]A\QSHHHHtHH1諟 [@LMH5@1[f.AVMAUIATIHUHSHH dH%(HD$1HL$HT$/t;IGHT$LL褚 Ht$dH34%(uLH []A\A]A^HEPHNL:MLuH1H5?8XZ?ff.@AVMAUIATIHUHSHH dH%(HD$1HL$HT$_t;IGHT$LLԙ Ht$dH34%(uLH []A\A]A^HEPH>LLLuH1H5>hXZoff.@AUMATIUHHSHHjHt!HMHL[HH]A\A]雳HH[]A\A]&fDSHHHMrHtHH1K [@L [ 1ɺH54>1[ff.fSHHHpHtHH1 [@LZ 1ɺH5=A1[ff.fSHHHhHtHH1苜 [@LIZ 1ɺH5t=1[ff.fAWMAVIAUIHATIUHSHקHtrHLHHQt-IGHLLH[]A\A]A^A_Z f.LY 1ɺJH5<AH1[]A\A]A^A_L 1EH5< f.AUMATIUHHSHHNmHt)HMHL[HHH ]A\A]f.HH[]A\A]ff.AUMATIUHHSHH~iHt)HMHL[HHH ]A\A]f.HH[]A\A]^ff.AUMATIUHHSHH.jHt)HMHL[HHH ]A\A]f.HH[]A\A]ff.AUMATIUHHSHH>jHt)HMHL[HHH ]A\A]:f.HH[]A\A]~ff.AUMATIUHHSHHhHt)HMHL[HHH ]A\A]f.HH[]A\A]ff.AUMATIUHHSHHNdHt!HMHL[HH]A\A]HH[]A\A]fDUHHHSHHdH%(HD$1UkHt0HHHH$输 H\$dH3%(u&H[]1H5nH AWAVIAUATEUHSHxdH%(HD$h1HZpLjpI9EL|$ AHL9HCtEt1HH@LHSHH`hHC0HPEH>uD$LoU 1ɺEH581DL$fD0AHL$hdH3 %(DHx[]A\A]A^A_@HHt$胋AIMLxI9tLT$MwpMtYI~HHHLT$yLT$ELHHI!DLT$GLT$IGxLxI9u(MME1M9uDM?M9IGHxG\tDL$L\$7SL\$DL$L9pXt L9uIGHPHzHH8HDL$L\$HT$HT$L\$DL$"EHDL$HL\$I!DTL\$DL$BL{S 1ɺ`H56E1!LQS 1ɺ@H5|6E1D$L%S 1ɺBfIMI9ELt$ AHL9HCtEtAHH@LDL$DL$HtlHHDL$]HCDL$0HPEHDL$1DL$uLaR 1ɺoH55E1L:R 1ɺjH5e5DL$LR 1ɺMH5A51E1LQ 1ɺlՉD$LQ 1ɺO`D$LQ 1ɺQIDL$LQ 1ɺ\1LQ 1ɺ^H54*E18-ff.fAUIATIHULSHH(dH%(HD$1H4$ HD$HHRHڅu]DHAAÅtHHGHT$LL葎 HL$dH3 %(u{H([]A\A]fHHRHt$H<$ LP 11H53!LaP 1ɺ1H53sff.fAUIATIHULSHH(dH%(HD$1H4$ڝHD$HHPHڅu]DH1AAÅtKHGHT$LLd HL$dH3 %(u~H([]A\A]DHHRHt$H<$ L[O 11H52L1O 1ɺ1H5_2pff.fHHHIGz f.HIdH%(HD$1HAHt H@Hu31H5L Ht$dH34%(u"HH@8HLH$蝋 fDHIdH%(HD$1HAHt H@Hu31H51LB Ht$dH34%(u"HH@8HLH$ fDHIdH%(HD$1HAhHt,H@HLH$ي Ht$dH34%(u!H@1H5L蟏 #HIdH%(HD$1HAXHt,H@HLH$i Ht$dH34%(u!H@1H5L/ UHSHHdH%(HD$1HAH@uSu.1H5Hݎ Ht$dH34%(uAH[]ÐHHHH$賉 ɐHKHH@H@fAUMATIUHHSHH~YHt)HMHL[HHH ]A\A]f.HH[]A\A]ff.AUMATIUHHSHH_Ht!HMHL[HH]A\A]ۣHH[]A\A]ffDAUMATIUHHSHH\Ht!HMHL[HH]A\A]{HH[]A\A]fDAUMATIUHHSHH\Ht!HMHL[HH]A\A]HH[]A\A]fDAUMATIUHHSHH\Ht!HMHL[HH]A\A]黢HH[]A\A]FfDAUMATIUHHSHH~[Ht!HMHL[HH]A\A][HH[]A\A]fDUHSHH(dH%(HD$1HAH@H)raH*s:,HHL$HH HD$KHT$dH3%(u]H([]@H9\H5H誋 HLD$H4$HxwHLD$H4$HH@H@mfUHSHH(dH%(HD$1HAH@H)raH*s:0HHL$HH HD${HT$dH3%(u]H([]@Hi[H5ɼHڊ HLD$H4$HxGLD$H4$HH@H@m)fUHHHSHHdH%(HD$1\Ht0HHHH$^ H\$dH3%(u&H[]1H5H 製UISHHEAt$ D\$(Eɋl$0Dȃt$8DEDȃED\$@DEDȃDEDȃt$PDDDȃ EDEDȃ@DEȋuk%H 6HELT6H5U6LDH 6H5F6HEWLQHt$XRL轕 H HHtu%HH[]1LO6H5@6fDH5*H HH[]ff.@HHH AH516WLHVH56RH6U6Q H(ff.@uFu^Hg6@ǀt 6u+H uH:HH1f.Hi6HHHH@HDHɦ6AVfAUIATUHSLH@dH%(H$81H$H,$Lt$`)D$@)D$0HD$PLt$HLD$ILL$LEH|$`HH$xHD$H$pHD$ HHT$(Ht/H{MugHkMHtfDMI<$IL$H1L H$8dH3%(H@[]A\A]A^DHo7HH$HHC`H2q7uDMt6LSJHD$(H9HC`Ht H@0HD$@HC@HtjHD$HHD$0HD$( fDHL腤 DH8FHm7H$HC`Hp7DKLfDo oS$A}荹ff.fUHSHp6H@HHH t ;uH[]@USHhdH%(HD$X1Ml7H$L$L$Ht$h$HJLDMɉ-l7LDHHT$HDMHL$LDMLD$ LDЋ$LL$(H\$0D$H$L\$8D$LLT$@HtH HT$XdH3%(uHh[]ffDl7ÐAWAVAUATUSHhHt$T$H|$H|$ dH%(HD$X1f衱|$,Ll$8Ld$0L|$HLt$@B|$(HHHMT$MRHSHt$0VAWAVHt$8H|$PwH0HL$XdH3 %(uHh[]A\A]A^A_菷f.DHGHWpA AHp0HGH@PH8fHGHIHWpHp0HGH@PH8f.SHH0H[fDAUHATUHLSHdH%(HD$1HLd$@Ll$H跽 H$Pt2EHL$dH3 %(H[]A\A]DukHI$HpIuIu@HtH;PtyH9Pu[EDLw@ 1ɺuH5iV1 rEYI<$j EY,ff.FuG3uDf.HMRSHH臌t [LU1H5Q蒹[ff.AUIATIUHSH(dH%(HD$1Åt&<tD<Ht <EHL$dH3 %(7H([]A\A]HL$ LL$LLD$H5X<uA<1H5BQLot<|$ vJ <<HtEMMAD$3A<tO<,@uD$ w tXLS1ɺ1H5yPf.1H5kPLi<É]<|$CfDATI1H5Wo UHSWTLbHEXH5ULHPH1aÅHEpHPHE3t-H5PL1aÅ[]A\fDH5OL1aÅuLz9 1ɺ]1H5jOfDLO9 11ɺYH5?O[]A\fD1L9 1ɺZH5O跶[]A\L8 1ɺ_1H5N菶5f.HGHWpA E1Hp0HGH@PH8%DUHHSHHHtlHp7HHCHHC H-HC(HC0HtHKLK(Lg 11H5%N˵HH[]ÐL 8 1ɺ1H5M蟵f.LHQtHGH@(fDWHH=^Qff.fATUSA@LLHl$ Ht$(It/AP8HkDCLHHL[1]A\kIxHGPLOHHLZvuL6 1ɺH5GP致1DI@LPH5PLHH1T[1]A\DL6 1ɺH5O)[1]A\fAUIATIUSHHdH%(HD$1LtHW8H5B Lp?ŅHH5 LAŅtFCP1E1LLHsLH$CP.#HL$dH3 %(H[]A\A]HCLHXHHBHLPSIV1H5OA<u*A<u#ILITHHYH9Zu ZD;Yt[1]A\1IHHH蔅tAD$$E$1AD$PEPELuDD;]Ls7HH@HHƒ:uI$HzHtK;]Lr[]A\UHH5KHSH;t H[]fH>LLAIH5vK1误H[]fDUHH5KSHHHOLHHE+Xt?{Lvs81HHHzUtFHHH[HLK]nfDLq1 1ɺcH5J H1[]LI1 1ɺgH5Jff.@ATIUHHS臧HHtGHi7HM1HC L_ 1H5AJLc(HktH[]A\@L0 1ɺ1H5 JGDHH=VfDHH=J6fDHD11LJH5JL11H5JH雭ff.SHH0oH[ffDAWHMAVIAUILATUSH(HT$Hl$`Ld$hdH%(HD$1; HD$@t@AEHHEHL$dH3 %(#H([]A\A]A^A_MI3.1ҋHTIGHHDHHHHD$H8H9wGH{ AEHD$I$mDL. 1ɺrH5I1ULLHLHD$HD$H0IIHT$1ILJ1RH53I~AVHD$ HHXZOfDAEHPI$֣fDAWAVAUATUHSHH5HHH(dH%(HD$1Ld$L18iHEHt$HxP+IHkHH5- He7ADžH5 H9E1H5;H9 LH5!H7AHEE/HxPHt$*HD$HHH5+ HE6ADž"H5H8SLH5H!7AHEEyHxPHt$*IHHEHHhH9LKUPLL$ Rf.AHEHHhH8HLHUIH5G1ѩ_AXHL$dH3 %(DH([]A\A]A^A_HEHHhHp8HLHIUDLH5 H6AHEEHxPHt$(IHHEHHhH8LIUPLL$ Bf.HD$'fHEHHhH7LGUPLL$ H5E1E1貨Y^HEHE1L`Hu7DATL[IH5EP1gXZHhHH47HLGIURfDE1LD$1LLHADžLHbmADžA@HhHH6HLHIUfDHhHH6HLGIUfDHEHHhHX6HLHIUvf.L) 1ɺ1H5hD/\f.Li) 1ɺ1H58D,HEHHhH5LAGUPLL$ ؞HGHWA E1Hp0HBPH8ifHGHWA AHp0HBPH86fDHGIHWHHxPHr0HH?ff.AVHMAUILATUSHdH%(HD$1HLd$@Hl$H2 tnH$@8uTMHpHxYt AEH$HPI$H@HEHL$dH3 %(uvH[]A\A]A^fAEАL' 1ɺH5B1]Hp Hxs AEH$HPI$H@ HEx4@SHGHwTH@PH81L\ +IH5B1膃1LB,IH5A1貤HCH 1LA.AH5A1~L11LA/H5AVHXL " LEȺ111LAH5UALr113H54A[f.ATIHLULHSvt'HLLH}vÅtg[]A\LOE1H5@肣1L% 1ɺH5@a[]A\f.1L"EH5e@,[]A\DAWAVAUIATIUSH(D <dH%(HD$1EMt< o<t7!AEc<H|$dH3<%(&H([]A\A]A^A_1ҾLmH8L` H-6L=# Mu&@Mt$A>Md$MA<$tL J1ɺ1L5DH5U?f.HL$ LL$<LD$H5J趵x< Ha6L5JHfD9D$ w u(D$9CwC 2<HH9DHsL] 1ɿM1H5>]_AXH-6< <Hƞ6L%IЉ<HH9s1L ILe] ۠Z^ g<m<HQ6L@HsL\u C ?<HH9u8蜘ff.UHSHHtHHH[]6fDH1[]AWAVAUATUSLH(IdH%(HD$1Ll$`HIILE5HLHHHmuIH5 811͚d)HcHD$HD1HH(\(HHHHHt:;Lj>H57P;1ɺV1QD$HSHrXH3t6;Lg>H5O7P;1ɺ\1A} LLM9AEt:LZ>{H5611裙yfDI}HhXIEH@HH HH56L PL6l1JXHZI}1HL~ŅMmM9,L/ fDEMt1LX6H55踘AUAu1LŅuL 1ɺx1H55Uf.HHx2L:Ie1҃L1?ŅL^ 1ɺS1H5-5H\L;,IH541赗L5L 1ɺG1H54Uf.Hl1PL 1L4H5w4>I}Y^AuLm 1ɺq1H5<4LL;1H5 4ӖHLHQŅL 1ɺ1H53萖f薎fDATIH5,4UHSHLHPH1@HH5 4L1@ÅH54L1@ÅHHtHPHH53L1Z@ÅHEXHtHPHH53L12@ÅHEhHtHPHH53L1 @Å[]A\@L 1ɺ1H52_[]A\L 11ɺH5f2-[]A\fDLi 1ɺ1H582DLA 1ɺ1H52הsfL 1ɺ1H51诔Kf.L 1ɺ1H51f.AWAVAUATIUHH5SHHHdH%(HD$81Ll$ HD$(LD$D$ 8ID$Ht$ HxPIHLH5 H ID$`HxPHt$ rHHLÅdLL9ÅI$H5 HÅnIT$TH5 HÅH5 H!Ht$(HI$pÅAD$T=H5q Hb!|$H5 HA$9!HHHD$Lt$0L-b HD$ HmH#L} MuH]LLHD$0D$HID$Ht$0HxPIH4L$ALLFZuLk 1ɺLH57/LL 1ɺ1H5/1HfDID$HL`H HL6ATI\H5.1蘑Y^HL$8dH3 %(HH[]A\A]A^A_ÐL`HHD HL6IATbL 1ɺh1H5X.DID$HHXH_L6SPLL$0H5.11ڐAYAZ;L 1ɺk1H5-诐f.ID$HHXHoeL6SPLL$0DADŽ$KHT$(H5 HÅID$HL`H HL16IATu_f.ID$HL`HHLG/IATn%HT$H5ϟHL4of.ID$HL`HoHLW5IATqfDID$HHXH/E$SL51PH5U,1_AXHT$H5{ HÅID$HL`HHL5IATHT$H5x H>Å|$A$ID$HHXID$HHhHOHL6UII1H5|+CXZ9ID$HL`H HLs4IATzaID$HHhHCLb5UPLL$@ID$HL`HHL4IAT輅ff.AWAVAUATIUHH5sF SHHHHPH17I$H5E HH@HPH17ÅaI$H5*H17ÅAt$THD H1H-3ÅE$AAfDkH5*HH127Å E$A6AA$M$IM9IE1A}<EuH_1ÅbAH5*H1D6ÅH0AE%L411ۺH5)ߋ&DL! 1ɺ1H5(跋H[]A\A]A^A_fDL 1ɺH5(1}Li3H5(11RL 1ɺ1H5h(/sf.IELxXLHHLg311۹H5(,L) 1ɺ1H5'迊f.L23f.1҃H5(H14ÅL 1ɺ1H5'LIEH5(HHPH14Å`H.H5iH1t4ÅMmM9,AUH5;(H1;4ÅuL 1ɺ1H5&褉L 1ɺ1H5&wfH5'H13ÅL 1ɺ1H5m&4xLx 1ɺ1H5G&RLR 1ɺ1H5!&,L, 1ɺ1H5%ˆL 1ɺ1H5%蜈SHHi17[t [L*1H5{%B[ff.AWAVAUIATIUH-n6SL}@HH΀HHHELHk(HC EIHCAHC0t HtHKHLLK(L8 119H5$H yI9c;AHD[]A\A]A^A_fDI$1L H5Z$!E1@D$ L] 117H5,$DL$ f.f;SHL;t[HHR fHH9HA<Iu1ۅu[1L/H50t[1 L ;H1H 00fDHyAH@uZD[HGH / HЉ?HPH9uff.foHG?LGoNH5/ODH? HL9uGGfDAVLw AUE1ATLg@UH-3/S1A6H{HH)HDڅAHIM9u҉[]A\A]A^UHG=SH_ H @HH9t;0tH1[]ÐHHxH}@HHDBtHH9uH[]ÐSf HGtYHLK La.H !B!HHHHHHHHHH)HH)AGL9u˸[@oH GoNObf2fHHWH3H3VH uHGHWH3FH3VH t 1fAWHAVAUATUSHH&veH-^-IAE1Lm@D}DIcHHHLEIHHJ-L9uH[]A\A]A^A_fHt1LZ,H5,$H1[]A\A]A^A_HH1-tFHcȃHVu t\1L6,H5^,踂1HÐ1L+H52,茂1HDHfH1@-tHcȃHVu t 1f1IfUH(SH虜 HHtI(HH!t HH[]L) 1ɺ1H5e+迁DLӘ 1H5:+蔁fF$G$FPGPf.WtHt$H|$ff.fSHHSt [L/+1AH5 +[ff.SHSt;t s;[DHߺH5W;Z[G;fSHLyHHtDH=7L 1ɺcHC L1 H5^*1LK(HCa5H[Ly 1ɺ]1H5**f.AWIAVEAUMATIUSHHT$ڑHT$HHHtHH٠Mt A<$MtAuH`DEus^L$hT$X>D$`jt(HF MtLH<HH[]A\A]A^A_T$PDH,qL= 1ɺ}H5$)~@LH腥L 1ɺwH5(~ fH L 1ɺH5(a~@HCL|*H5u(&~HBLq*1ɺH5@(}@HALa*1ɺH5(}b@L 1ɺtH5'}H1f9\L 1ɺzH5'a}L 1ɺH5'9}Ly 1ɺH5`'}|@LQ 1ɺq1H5;'|fAWHAVAUATMUH1SHXHL$H4$dH<%(H|$H1HjHE1RAQ$ RD$1}H HPHMtH$DE4H틌$…tEHD$HH4$DEHxHOo HWHAP1HBW$AA)LHHHD$HAXH'HD$H@^#1L|$@Lt$8Ll$0Ld$(HD$@Ht:MMLLHH38H9l$(uHT$0H;T$tHL$HtH9uHl$8HHD$Lt$@L`Ml$@ ID$@[MID$@Y@9I}(Hr%IE H@@Ht HЅ HD$H@Hx!I1ɺPL'Au(H5$1xz^_L 1ɺE1H5$PzH(6H|$HdH3<%(HX[]A\A]A^A_H蘛Ht#HL(rtH$DHD$Et[H$DEHH8~L 1ɺ!1H5#y:f.?AHHD$GL+BG(cfH9H=H€H=kH€H@PH5 H8/IHL 1ɺ1H5#x9IE bH*H$+H%HD$@nHD$HD$HxHGH@XLi 1ɺ1H5S"1wHD$9HD$LH8HPކ HD$@`HD$LH8HP} HD$@.HD$LH8HP x HD$@HD$H@Hx躑HMM(1PL#HD$LH8HPJ !HD$@HD$LH8HPu EHD$@jL 1ɺH5 v HD$It$LH $H8L@Ym HD$@ L 1ɺH5  PH H5#P1R: gH D$D6WA…A<$b\A}ML*> HDH< PHPSD;|$r D$;D$ HDT$]DT$HtDT$H1ɺ D$LH5[PHAWAUP1SLL$`fH0HDT$ $D$\$LKHv LkSI1H5fXZD$@LN H5nfE1fDL$] LL躀- LIwL虀L1ɺz IH5K1eD$XMH 1LH5eALL$0L 1ɺH5eL$L(1ɺg D;l$  H[HtH1ɺ D$L+H5nPHAWAUP1SLL$` eH0H.]@HHAE11dH%(HD$81Hj1jjVHH Ht:H $uHT$8dH3%(u>HHfDT$1L 1ɺH5Yd1`\;t@HH?1H;H5 Xt;HD ;A~H1+jL H5cX1={;ZfAWEL,AVIAUATAUSHH$L$L$H|$0H$H\$ Ll$(dH%(H$1EILEH5} Ld$R>#cMLH$HLjAWDL$,H U-LVIHtxH 7Ld$0bDI}ZuLELLsX HHLjjAWDL$,LD$0HL$@HT$8H Eu!HH3HuH|$(HǠufAHL$xdH3 %(DHĈ[]A\A]A^A_D$ LU 1ɺCH5A 1aDL$ @HI~HjjAWDL$,LD$0HL$@HT$8H dD$ L 1ɺ_fD1ɺRD$ L H5 maDL$ #nYff.AWMAVEAUIATIUHSH8dH%(HD$(1LT$pL\$xD$$H:HӸHt8t4HD$$MELP$1HLPASARH 1L 1ɺH5 `1HL$(dH3 %(H8[]A\A]A^A_@HD$$1HD$P$PASL\$(ARLT$(XH LT$L\$uVL$$pID$L\$LT$HLT$L\$u1T$$fD?fDt$$M1HSELLPASL\$(ARLT$(H uD$$LT$L\$Wf.SHtHSXH%r[ÐsH[HÐSHGPH1HWHHHHxO HtHH[nfD1L? 1ɺyH5+ ^1[AWIAVEAUAATEUHS1HH?HT$dAG\ ueEtP LuڃHEEڋu؀EE؉؃ EEH[]A\A]A^A_H|$t LHu@L`tIGXH%rɩ@uIHAڃ EUfAWAVAUAATIUHSH7HDO,Ht$dH%(H$1H"3 HDE]HGLGHHLHUPfHDŽ$)D$`oJhoRx)D$p)L$@)T$PEH8HoHH5R L)\$`obHT$@)d$p&P IHHEPIVHHI<$HM HHI|$E1E1jHjHT$(RLH AƅDD$EudAH$dH3 %(DHĘ[]A\A]A^A_fH@IF HHDfL?I|$E1E11HH8T$,t$(H|$4AƅAL$,WHSvAUIٹPL 1 H5[It$XLZLHƸGP.AƅL 1ɺ 1H5d[L 1ɺ 1H5E14[1ɺ E1Lb H5U[LI 1ɺ 1H53Z\f.HH5D$4L`  PDL$81Z^_RfSLZIHBIS H@PLR8MtEIHG1ACt APLA+SAP(HHOPA@$)HPVHWH7AH [LL  IH5O1Y1[DAUIHATIUHLSH貾HtMHHH$Ht2H"HHtRtHL9t HH[]A\A]1@L 1ɺ1H51]YLsL 1ɺIH51,Yf.ATIUHSHHt uAHMXH"r6H!r/Ht:AT$uH[]H A\Hf1[]A\fH%r@tf.AWE1I1AVAUATUSHHHW8 t$lH$IIdH%(H$1HAHDŽ$H %j j1jPHD$HH H]D$Eu@E1H|$(H$dH3%(DH[]A\A]A^A_Lt$(L#yLHD$pzHŋD$lD$jtD$ED$lD$k Ht D$l0S H$D$DE1HD$XH$HD$PH$HD$HH$HD$`L|$8LL$XLD$PLHL$HHT$`H|$(IH$HD$jt)L=)WHLAAEE  HH=AA|$kE+EtHH= €HD$8E111HDŽ$ HP8jjHIjH I%A 1P HD$0H H H$11HD$ H$L$HD$H$L$HD$H$L$HD$0LL$LD$HLHT$ H|$aHH$H HH=€uZH$HILL$01LLL$H5 IH@\@HƹH=t uNH$H1LH5 LHu$$u1HH|$]H$ H=HAAEEHH=m €`H=HAAEET$DtDH$H=l Ht"H=HD$DML|$8D$lt D$DAf.$$}V$$b;1H=P H$k HHL$HHLR ]H$HXTl S H$H= H$_k HHL$HHL-S H$Hp8Ht#H= AAEE)Hk H$@H=m HDŽ$j HHHD$8E111 HP8jjHIjH I%A 1PH HH]H$H1L$L$HHD$H$MLD$ HL$^H$Ht'1H$H$H5b SEzL|$8H1ɿLKH5v IW8HIH I%A кP1PAXHAY HXj H$Lgt$pL SIH5 1PY^fD賦5 H=R L$H$H$HDŽ$i HD$H H|$H$LS` SH$1E1Lt$8z^fDDHrH@H8AtDLfHATI1LhH5 OXZH$AD;brHD$8E111 HP8jjHIjH I%A 1P\H IH/ H$H$Hl$E1H$Ll$xHIL$Ht$ fMHT$LMMHL IH;$uHD$H;$uH$HtH$HtL HH5z LT$0HT$ hCHT$ LT$0Ht@t,H5ǾHLT$ ?CLT$ HA@7L|$8LdLIH5i 1NL H|$qg @HD$8HL1HP8HIH I%A кPH5 1M[A\fL 1ɺBH5 MHf H$%@L 1ɺUH5 IMHf H$ @1Lw 1ɺ?H5c MH$f1LG 1ɺRH53 LH$fHjE11j11 j$PD$H HHlHT$LD$ 1HHL$MS H$H$HZ [H$x0@8HHe Li 1ɺ1H5S L|$8K DHD$8HL(1HP8HIH I%A кPDr(EHB08AH|$87f1ɺE1L H5 >fL 1ɺ1H5 >L 1ɺ@H5 1E1b>h6AVAUATUHSHAMMx D9w@HDH\ÅunLU 1ɺ?1H5? =PfHML 1PFH5 1ATAV=H HH[Åt[]A\A]A^fD1LϿ 1ɺMH5 g=[]A\A]A^ff.AVAUATIUHHSHHSH}HHLm 1ɺ HtIHCPLKHHLD@C[@uqHDL}t)11LLjttH[]A\A]A^@L 1ɺ 1H5 At$IF@4IVHt$H;1)HtdIVBHtOI~vTHIkTHL AVIc 1H5 9XZAD$HEPHUH1H;Hw* IHC E\  Hi?HH$.E1I9l$(ImH{AAL$H$HEMED$ bAT$E1LDHEPHDT$H@`% H H$AD\$H<$D\$ADT$E11HLLARAUASH|$8 HD$XH HH|$8IEHEXCH2sC,H-fHFnH<$HKLHHD$0L9H $H.HD$Hl$HHl$HHDHEHT$ HD$(fDI}7IHMDM~IG H@H LLHD$I}BRHLJ t$0W H5 t$0P1LL$(7IG H H@XHtIVLHJP1H9Ѕ MMtD[(EgC(LQL9 % IH5d 17L&LLHIH* MIL9Ll$MIfDMmM9IEL;uHxIUH;HHHRHtIEHxLHHIIEHPuL 1ɺ7 H5 96 @Ht$H;1H.H%HEXH-H* RHEXH0HKH@^fH2HL#HL}PHD$HH HD$AL$E1HH0ED$ H{H$HD$(LT$fD$ IB@^U LT$MNHH1uH1 L H5k 5ZLY2Ht$LLIHLT$I8fIN H;H$)$H5 H)B0)$0HD)$)$)$ HDŽ$@AoOhAoGxHB@)$)$o)$oXI@)$H)$HD)$H o )$ oh)$0?' HD$H H;H$H w H5( ' HD$0HIVHIH 4 H;$ HD$8HZIVHIH # H;s$ IHCH;L1ZIHD$ AT$LHD$ HEPH@`% HH H$ɉL$HHAAD$(PAUL$`QHT$(DHt$XH|$8H IHC,6HLT$\MH5 IL 1 2LT$Ht$LOnHEPAT$1LHH@`% H H$L$NHALAD$(PAUL$ QHT$PDH|$8H IHjC,iHLH5V IL2 1" 1Ht$(L9O}L* 1ɺ$ H5 1fE1L=(MHHt$E1LHHHP:Aƅ HײHt$E1LHH AƅRL 1ɺ 1H5u !12@H耲H@HH<$HEXH% @ L$LHHL$0L9^D@qHt$8HH-AƅRL 1ɺ 1H5 Q0b@L 1ɺj H5} 1E1$05Ll$LJLG : IH5: 1/C(IHtE1LHH(IHtE1LHH[SIHET$EIhAULE1[IEH@tcu\IHtPJT0HtFIHJD0H@XHtt"E1LHHfAE;}LDL4@IIL8dHPHHJXHt Ds,tIEH@ 4E1@uYLHH# L 1ɺ 1H5 :.f.Ly 1ɺ DH0IIJT0K,I}dH L[ IH5 1-IEIUH@P1Bt AEL+BAE(Au$H|$8)HJ3AE8AELt$Mm9CƉD$L;l$0VH<$Hl$HHEXH%sHt$8HH Aƅ HEXH0 HUHH=K=Huz_H}#HuhL|$H;1HLHtNLHL@LHLHAƅu.L 1ɺ 1H5 },t$X1҃H|$8C0tPEY tJLHL9t7Lt$IEE1LLHHPwMmI9uD$DC,@IG(HD$fLHHIIIhHt3EL$E:LHHIhIDdIHED$EyLHHIIL 1ɺ~ H5i +DHt$8LLHmzL> 1ɺ H5% *I}GEHL t$I1] H5 *[]aL٬ 1ɺi H5 q*<@L 1ɺu 1H5 G*XfL 1ɺn H5p !*@HE1DHLm t$I1 H52 )AXAYDDExMt@L 1ɺ) H5 )L 1ɺd 1H5 )KHHHzH@L 1ɺ H5x ))@1ɺ E1LZ H5M (fH<$Ht$LHHL;Aƅ! HIH HpXH;HD yIH IupH;Hl;ZHH IEXAu$H@PDAD$LuHHL$HL$ EMTH|$8LLA*E fHEXD$C,@L1 1ɺt H5 '@HҼHt$LHIH\AƅHt$8HH1AƅfL 1ɺ 1H5 U'fHEXL 1ɺ H5w ('cLi 1ɺ H5P '@H`H@^u>H<$H@H4Ht$H;1HH[ HEXH0HH@^t&H<$Ht$8HHFAƅHEXAft$t$XHt$XH$Kt$X$La 1ɺy H5H %@L9 1ɺ 1H5# %f.Ht$LHHLQ fAƅlAD$^E[THFHHt$LHHPpLE8Aƅ HIE[+ H H;H HIH IvpH;H7ԉIH IvpH;1躉IH ENTH|$8LLHA LLM9Lt$IWE1LLH:{M?M9uUDL, H5 >$yfH;H̦ HH]HH|$8H@NLB 1ɺ H5) #L# 1ɺ L 1ɺ 1H5 #1ɺALԥ H5 x#A1HHD$pHD$xD$HD$\HHD$ HD$HH$E1E11HD$(Hƿ jjjjHL$(H IHL$$tZLjE1E1j1ҿ jjHL$(Ht$H覢H IH@$$1LHL$hLT$(HT$`LL$xLD$p5Ht$pLT$(H9H=NH|$xH1HT$\LT$(H5 LT$(T$\9T$HLT$8HCH % HDȉT$0HL$(CEG?L F^;1ɺ1L H5? UML H5 11*SDIL DL M;L 1H5lj +8脼=];H  H_HDH1PHډ L a];PL H5] 1RpH 11fDH=!m;lHHxH$L-HD$L5Y DHhHLxLLtչLLt1MH l;HW\ H=,;RHT$H5v,;\t$%=`]1ɿ1rL 8,;L H5: UH=,;!蜽8L +;1L1~ PtH7\ PH5 1AYAZH1ɿ1L ;;L H5 H=;;d8`1H5w L `;;PH[ PL} 1oY^ML^ 11kH5& <苼8=Z;H } H~HDHL Z;PH[ PL} H5 1RH fH$H5J;HH5eZ;۽HD$8H9$L 9Z;1ɺ1L H52 H蛻8L i;1L0| PH yPH5 1_AXL Y;1ɺ1L H5 Q#8|L i;1L{ PHe `P놽蝻ff.fAU1EIATIHH=7i;UHH9: SHHztE1IH i;HX H=X;QtTHDLHH[]A\A]QIىL 1H5Ƅ H1[]A\A]IL 1H5 H1[]A\A]AVAUATIUHSH^MŅt_uBMtL$0LHHkDD$0LLHHD[]A\A]A^f.IH1H8 H=ŗ; H=;un1ɺ4L ;L H5 @H=u;VH=Z;AD211DD$0LLHH#LC 1ɺ1H5 *[1]A\A]A^L$0LHH1IHپH7 H=;tiH=;H=;L z;1ɺP1L H5s H=R;=PLw 1KH59 OLB 1ɺ@LB 1ɺ$H5 @L 1-H5ف f.L)B 1ɺ!H5 q@8l=u;H  HGyHDHL X;PHہ PL H5G 1R9ZDH 11eAWIAVMAUATIUHSHHHt$L$dH%(HD$81F<LLIHIH<$HD$ұLHD$űK|=ELl$HD$ ILl$Ll$x5f;H|$ H|$IHHP@X$IuL|$0HT$0HT$AELIu LLIu(HLH$Iu0LtIu8LLeHΣ;LH=|6; ,@HHLM$PLD$Ht$ *ZYH\$8dH3%(HH[]A\A]A^A_DZ; \;L={6H{6HD$M/I9u fDIEML;l$IIw(HWuIw LGuL[; ;$bL-{6Hz6HD$IUI9uAHIH;T$-HA}uIu(HHT$(輴HT$(uIu L觴HT$(uLL 1H56~ L1L> 1ɺH5~ +1l@$yL-z6Hz6HD$M}I9uXfIML;|$EIIu(LuIu LгuL譳ff.fHHWPIHOHL ݱ 1HHH@PHfHHWPHOHL MȿHHH@PHff.@HL X QMHHHHDAWIAVIAUIATUHSHH_PHLL輲H3H@u0HHMHMMRL,ZYH[]A\A]A^A_HL LRMLAXAYtHUPHHMH1ML HHH@P^_H[]A\A]A^A_ATUSt[]A\f.L+| H5{ 螹=x;te;L%w69Hw6H+L9u EHŋCHLK8LC0HK(HS Hs{PXHZoHHEL9u;[]A\@LY; 1ɺH5z ]ff.;D=;D;Ð; p; r;UH5 H SHHH?AH=HuwH;H~ H5~ AL |IH5~ 11LD H5t~ @H11[]H;H= H5` :AH=ΈH~ HH5~ H;u7 AL6 IH5} 1sTfD@H;H} H5 H@HLJ UI1H5} XZAWE1AVIAUIH=Ϗ ATIUHSHhdH%(HD$X1 HD$8HDMHHǹ 1 LS H|$L2YIt$I $jH#} AuML$L| PH} H| SH=| P1t$Ht$Ht$HUZH@ADžuA@HD$Ht2HH11t$(H=| t$(t$(YH ADž}0t3HHu011t$(H=| t$(t$(YH ADžH|$0t$ t$ t$ 5};5o;5a;LD|$`H0E Hl$HH5߃ H H}>H=_| HhAt$Ht$Ht$Ht$HNH Ht$(t$(t$(YH HЧHL$XdH3 %(DHh[]A\A]A^A_f.L1} 1ɺ1H5{ 菴C fDH1H=^{ 1t$(t$(t$(XH ADž6M1L { H5z *$DH@11t$(H=z t$(t$(XH ADžM1Lz H5Cz ófDH L5 11 H5z 菳pf.M1L8z H5y YS@DHL{ AWI1H5y E1XZM1Ly H5iy @M1Ly H59y 蹲迪ff.@=;DH=;@HXdH%(HD$H1v;tH_;1HtZ; 5F;t HL$HdH3 %(HXH% fHT$(H)D$0HHD$HHD$(HD$@D$Ht$Ht$Ht$Ht$HPMfoL$0HD$@DL$0H0) ;H;Ex ;tRLz 1ɺD1H5x 聱1Lz 1ɺEH5w `j;D1L2z AH5w ,-;#;uÐH5;5;5ږ;R;H(fDATUSH~eLHM~HHVHHE I tbDUH RAQL w /H5v ELz LD1RA[HXHH5 [L]A\&fD@tNuH$:H1RH5hv =Lz XHZH5@ HL){ 1DH5,v 謯[1]A\DH1RL z 3H5u w_HAXHLH5 []A\KLy 1H5u 4fL)y 1$H5u  [L1y 1)H5\u ܮ+Ly 1AH5,u 謮H1RH5t 8LDy wYH^HH5 !AWAVAUATUSHxdH%(HD$h1HHwLHLy I1HչVH5qt H=Ć LkEd$D$ H|$0HD$YI^H5t jPH1Lt$8H=Ot 1t$8t$8QH Ly ú0EMtBH1L1t$8H=dt t$8t$8gQH L?y úH|$@t$0t$0t$05;5;5;0DD|$pH0ELd$XH5s{ HB I<$B6 H= t HÀۅAE1E1E1t$Xt$Xt$Xt$XEH HEt$8t$8t$8sQT$(\$,D|$0D|$4DHؼLdw LIH5ip 11H$dH3 %(AH[]A\A]A^A_fDH$L~HIcHLv ATIGH5o 1趡_AX뀐H(WLv IH5o 11If.L=-fDL# 1ɺS1H5mo 15H註LLw hIH59o 1@HpcLv ICfUHSHH?ZtH[]DHELn ~H5n LHH1zH[]ÐAWAVAUATUSHHIH5n IH}H )H=Ug HÀۅH}HH5n *I=H}H H5> F)E4$IMH}1H5mn $)HHH5bn HyHtAMH5Wn H`HtAMH5Gn HGHtAMH54n H.HtAMH5%n HHtAMH5n HHtNAM GLm 11ۺH5 m H[]A\A]A^A_fH AW1ESLEu 1ɿH5l 蝞XZfALl 11۹H5l gxfLl 1H5rl HH\LHH&qtHjLL11Lq H5g e(*#HLATLp DLLJp 1H5+g PLLp 1H5f Ř HLATLBp DLLp 1۹ H5f mLLp 1۹H5kf 5;ff.ATIUHSH2t []A\fDHEHM $Lp pHH5e 1×XZ[]A\f.ATIUHSH>t21Lf 1ɺ H5e t[]A\DHEHM $Lp pHH5fe 13XZ[]A\f.ATIUHSH2)t []A\fDHEHM $Lo pHH5d 1ÖXZ[]A\f.ATIUHS~1fDI$HIHH1ɿPM1AL-e H5c 聕Et$XZHH9uH[]A\A]A^A_LLd 1H5kc H[]A\A]A^A_'MH59c LNn HIt$L[]A\A]A^A_, MLm H5b yAWAVIAUATUSHxH$H|$Ht$H$HD$8H$HT$ L$LD$H$LL$0L$HD$(dH%(HD$h1I菆EH޹A$H= @@@ z; z;MHT$ A}H LDHt$HLT$M{L\$8H|$@jHH ML b MLDMLDHHDMASLDH c QH xb AVQH c RHxb RHc t$hRHc LT$XARRH$b Ht$`VRHc AWRHc SRPL$1H$LD$LHL$HĐDLUNA$HM1Ll PEH5` P1t$(t$(S胒H0D|$@Lt$Xt$Xt$Xt$Xt$X`+H H\$hdH3%($Hx[]A\A]A^A_Ht$H ( HSMH|$@jHLDHMHDL a MLDH a AVQH a RHa RH` Ht$0VRHa AWRHa SRPLl$x1H$LXD$LHL$H`DLuoH1SLL$(L k H5r_ AD|$PLt$hXZt$Xt$Xt$Xt$X *H 1DL- E@A$MLj 1ɺPEPt$SH5_ 1ΐH FDHH|$@jHHDMMLDL _ RH_ H H` RHu` AWRHu` SRPLl$X1HT$hL'D$LHL$H@DLA$HM1L'` PEPS5!AU81AATL%c Li UHSHHdH%(H$1HHHl$HD$H5] D$4HD$HHH$Ld$PD$pHDŽ$DŽ$1ɉ$P1W?Y^IInH;H5 EH$H>LHCHtVH`H$dH3%(uiH[]A\A]ÐL 1ɺ H5\ 豎1DHMLh H5\ |X1Z聆H=t;@=~t;Dnt;DHZt;t.H=Vt;tR1H=8^ vur(t;H1L:h ?H5\ ܍H=t;uLKh 1ɺC1H5[ 豍s;DLQh 1ɺH1H5[ s;HHX5s;dH%(HD$H12 hs;Vs;t"HD$HdH3%(^HXfH9s;H 1] HH HT$ HHT$8HDD$@d$0HHD$0t$Ht$Ht$Ht$HR'foD$0HD$@DL$0H0)r;Hr;Exr;HD$HdH3%(Lg 1ɺd1H5Z HXMDLag 1XH5ZZ $Lf SH5'Z L)g 1ɺa1H5Z ϋq;˃ff.q;uq;H5q;5q;5q;U-q;H(fDAUATUSHXDsq;dH%(HD$H1Et/ Tq;u 1&H1ҾHJAąu'HL$HdH3 %(HX[]A\A]H`tL$}H|$ jL Y AULcH Y 1H5Z 1ZXZ1Ht$8|$ HT$T$u+t6D$ t$8t$8t$8t$8]#H D$ NDHH;ff.AWAVAUATAUHHSHHXdH%(HD$H1}dHuy HcH>AHL$HdH3 %(DHX[]A\A]A^A_@D-o;EtD-o;EtLLM9HD$E1HD$HD$H$&f|$DDM?M9IGHT$H4$Hx@m4tځ|$uAD-!o;E&D- o;EH}H] HmADD-n;ED-n;EH}H\ H-AD1E1LX H5V Y@Etc11EOLc H5]V 'AELgX 1E1UH5!V !H5 V 1ɺO1ALcc A$HAŅH`LL5[ LhHyH 1H|$ jH5V Lc1QH QW L _V QH vV AUQH ZV AVVH5V ATLd$xH@1ɋ|$ HT$LAŅD$(LL^ 1H5U EI<$1H57 5HH}HIHH`H`HHhX7LL]vH59fDt$8t$8t$8t$8CH pf.D$AAA=,P~emDHLL.U P1H5S XZf=(=*j=$uLHX Lga PH5S 1AQ^YLa ^H5pS 18S7LLa 1H52S LL9] 1H5S ̄@@BLL``yLLHLLH\t;HS7t/E1BEEL 1ɺ1H5eR E1,LT 1lH52R -LLi\ 1H5R ̃LLy_ 1H5Q 蜃LLb[ 1H5Q eLLB` 1H5kQ 5PLL_ 1H5;Q  LL[ H5 Q ׂ zff.fSHH<w/HLr HcH>@H[[fDLR 1[H5P SAWfAVIAUIHATAUHSHdH%(H$1D$8)D$p)$)$)$@h;Lg;#HH ATL$_ H5O HHD1ɺ)P1肁_AXH}hL|$p@LÅHHH=fU HE1ɄH=oU H€H EHQ u(LHDЀ|$pLL$ HLDHt$MHT$HL$LD sH|$PjHT$ H5P H hQ Lc1R1VLL$8H5EQ AQL O VHt$8VH5JQ QH O AWVH5O ATQSVHL$pH5Q QH ^O HpHt$h|$PHL$8HT$<ÅD$<(D$8tALL] 1lH5N ft$ht$ht$ht$hH H$dH3 %(H[]A\A]A^A_@L\ 1$H5M tfH\$@HLL$(HH` Eu(LHO HHDL|$pHt$LDMHL$HT$ LDLD$eqH|$PjHT$(H N RH N QLL$@H O AQL M QHt$@H O VH5O VH5M AWQATRHL$hHQH M VLD$pH5?O APLc1HHpHsH-H`HL:Å1ҾL=HLcfD$<D$8L=,~nLL$He1iH5K LN @H11ULL$}Y^D=*m~sL[ 1|H5K g}f=-uLLR[ 1ɺs1H5nK 3}MJA>fD=(HPLM 1H5K |XZDLY 1 H5J |E1rL1ɺ,1H5J |f.HyL}Z YA)HLZ )HLZ LY 1ɺo1H5J {sATIHUHSH@dH%(HD$81: a;a;HH LLqL H5I HHDH1ɺP1;{HmH|$ Y^jLc11SL J H J H52L _AX1Ht$(|$HT$ wD$ to=.t/xgHH=N t$(t$(t$(t$(H HL$8dH3 %(H@[]A\Ð=.tt|H1PL1LyK H5hH 2zXZfDLyY 1ɺH5:H zH`HLEfDL11LX H5G y qUSHH_;dH%(HD$81t _;u"HL$8dH3 %(HH[]DHkH|$E11LcH SH H5J 1Ht$(|$1HT$ ÅtD$ y$L\J 1H5G xt$(t$(t$(t$(H @1L4X H5F xL_X 1H5F zxpAWAVAUATIUSH(D|^;dH%(HD$1EDT$ uJH6DT$ AH\$dH3%(DH([]A\A]A^A_fILOI 1I3H1H5E w8L8I H1L|$Lt$]fDDL$A1ҾL69ILI 11GH5E KwakAWE1E11AVL1H=H jjUjmH0yD$ ALDW H5!E 1vDT$ DL$A.tjE Af%f fA@M/1LV DT$ H5D tvDT$ Kf.H=> HH=YJ LD$AAE҃E0LW 1H5D uE1D$DT$ LdW A-u2LW fDH5C 1uE1^LW AtAL*G 1H5nC 8uE1EDT$ uJLALU 1H5(C tLU L5V 1H5B tM1LV H5B tE1e1L.F H5B @11XtA.XlAWAVAUATUSH(dH%(HD$1@Z;IHH$H=Hd AAEEAA$HH= €H= H€1L|$Lt$L-aE \DDL$A1ҾL29ILD 11>H5TA s1gIM1ɺ'H5)A 1rAWE1E1AV111jH=pD jSjH0AWHH= tuH= H/LXU 1ɺ4H5@ hr;DL$AuuILKU 11LH5g@ 1rAHL$dH3 %(D H([]A\A]A^A_@uH,$HH= tA.aAvA]H= HA-hD$ƒ8LU 1ɺ1H5d? .qfDH=|a HA$AfDfH R@LlS H5> 1pE1mDL$ LR H5> 1gpDL$ 3DDL$ 8LP D$tHH= ELB AH5> 1oE1LR nA- A.LBS rA&L\S tA'LCA vhD$H= H€L~R peL@  A&HL ELELS 11H5< nL[P 1cH5< nDL$LR 1ɺ1H5< snFLGS 1ɺ1H5< MnDL$(LR 1ɺ1H5X< "nL&P UffAWAVMAUIHATAUHSHH(E8dH%(HD$1AzzAHH=] HA7H=R HuA 1S3H5: 1{lXZAWt$E1E11j1HH=> jSjH07AADHL$dH3 %(D2H([]A\A]A^A_fAuHH= HH=1\ HA~fDAp1E1LN H59 yk<@H )H[ D$=.=-A =%H= Hރ#€H= H€H1H58 IPL'= 1AjY^ fDAD$GH=] H)ILP 11H5s8 =jHl =&HHHdH= HEH= HvHL6O I1RH57 Ai_AX Ig1L; H57 AgifAAAH=* HtRH=i HIL"N 1ɺvH5#7 Ah]AtH= HILN 1ɺH56 AhLM zH56 1E1XhHIRLM 1H5]6 E1$hXZHIPL: L N _f.ATUHSH@dH%(HD$81&M;M;t{HDe(YH5B8 1H|$jLc1L m6 ATH q6 VH5 : SH Ht$(1ɋ|$HT$ Åu5t$(t$(t$(t$( H HL$8dH3 %(uH@[]A\Ð\$ _AWAVAUATUSHL$dH%(H$1?HHIHH$@MHHD$AąFHH=: 4HU H=8 Ht H=8 HHL8 11AWL H54 H- e_AXH<$-LLLXH u5 H|$pjt$H4 Lc1QH 4 H5w8 AVL r5 QH P5 AURHS5 t$@QH i4 AWR1ATQH g4 UH$1Hp|$pHT$lHDL$lDA‰uH}1H5 kHH=FU H€HƹH= $$$$H hLyK 1ɺU 1H52 AadH$dH3%(DbH[]A\A]A^A_@D%QJ;EtD%AJ;EtMH=F LAAEE$ HLHL )Z HtH%HIAWp LJ SH51 1c_AXLI E1A H51 ScLK 1ɺ 1H5c1 -c@fDADL5iS $ Hڌ D$$HEHl$PLLt$HD$(HD$lHD$8HD$hHD$0HD$pHD$HD$xHD$@H1ɺ{ t$H50 1L J t$ AWLqbHH=6 H@@H @LHHT$fHD$H)HNLHHLM9H\$XE1LIf.HsL$HAL9uH\$XEIcHvZHD$pHLM9Lt$HH\$HfDIt$LID$Hx@Htu耼ulI|$"HL$pHcHHXIHH"AWHD$PLII 1ɺeH5// 1`$AYAZM$$M9[H\$HHHMH=3 Ht$0t$@t$(t$@t$0t$(LL$8H0iHt$@H|$T$l<|$$&RLI AWLfDLF  H5. _$A$$$H ^fDL1ɺF 1H5- _2fHHt$0Mt$@H=_2 jt$@t$0t$(LL$8H0HAĺ AWLH5R- L2 _Y^L2 1ɺ 1H5%- ^H`D$$/fDLt$H= LvZz_D H=O1 HZ H=9k H 11ۺ H5! 1St$8t$8t$8t$8sI,$H fDL1ɺ 1H5u! ?Sjf.DAAE[I>1H5q& j Lh& HHt.I}HƻpHHLLL=H^ H i H|$jLc1AWH5 L  R1AVQH  AUƣH0Ht$(1ɋ|$HT$ }Dl$ t$(t$(t$(t$(H Ey2fDL$ L<7 1 H5 JJD1ɺHL.u* LL7 H5 QJHL$8dH3 %(HH[]A\A]A^A_fD1@11HLuq LLM6 H5 IDt$(t$(t$(t$(H Aff.fUS1HH/;dH%(HD$81/;H;1H|$E1LcH [ H5N 1Ht$(|$1HT$ 蹨D$ Rt$(t$(t$(t$(H HL$8dH3 %(HHH[]fubL 1ɺ 1H5 H HLT5 H5 ^HYfLQ5 11ۺ H5` *H%DE@L4 1ɺ 1H5% H' GL 1ɺ 1H5 H G?ff.HGXH$H&H'r{H(rt umHxhH4raH-rZH.rSH/rLSH3uGHCXu>H7r7u0u)H"r"H!rH[[Ð1D1[@AWAVAULATUSHHL9tVIIL5"7 fH{t2Hs1LLŅt@+;D$+;L2 KA$HLH;Lx7H52 1H ; H|$jL  LcS1VH51 AVQH  AU蛝H0Ht$(|$HL$HT$ ODL$ bAL2 11ۺmH5 Dft$(t$(t$(t$(kH Ht$8dH34%(H@[]A\A]A^DH@HL-mLL_1 1۹H5  CH`mH`H UDL6 H5 11C%DML>1 11QH5 WCfAt~ED$u;H@BH`7HHLHHTL1ɺ}1L1 H5  BA$L11Le hH5 B:DAVAUATIHUHSH@dH%(HD$81BJ|(;Aj(;3HvuNHL3ÅLLH_4H H|$jAVLc1H  RH H5@ AUL  R1S肚H0Ht$(1ɋ|$HT$ 9\$ t$(t$(t$(t$(DL$,H AEHH=} u?W H5o 1L0 0AH`HLf.HL$8dH3 %(H@[]A\A]A^L9/ 11ۺ, H5 @t$(t$(t$(t$(DL$,H At\L5/ 11ۺR H5 f@VLL. 12 H5k 5@%L11L M H54 @ 8fUSHHHHdH%(HD$81HHIL. 11 H5 ?1H H|$jH K SLc1RHvp L P UH5 QH b R1 H0Ht$(1ɋ|$HT$ žŅtLt$(t$(t$(t$(H D$ x[HL$8dH3 %(HH[]fIٹ( 1L\ H5 >L- 11. H5 >Iٹ1L- / H5 c>Xi6fHb @Hc @SHH00H[0fDHGHWA E1Hp0HBPH8yfHGHWA AHp0HBPH8vyfDHGIHWHHxPHr0HH?wff.HH=-a ff.fHH=> ff.fAUATUHSHH5, HHdH%(HD$1M1H5, HIHttHELHxP\IHHHT$H5, ÅL$A@L1H<ÅHEHHX 3fDL 2, !L/ H5#, 11) 1890H4H U1L) IH5) 18D811L) H5( 8D<11L) H5( 8D@11L) H5( 8DD11L) H5^( _8DH11Lx) H56( 78DL11Li) H5( 8DP1LZ) H5' 17D411LH) H5' 7X-H1ɺ[I]A\L) 1A]H5' 7fDAUIATUHSLHILd$0HxtHHHrHHHsAHLHFPLNHHt$8LAŅtgHHxWHS1L狀\HRPHRHHHenAŅtNHA[D]A\A]f.1L׸1ɺH5s& o6HD[]A\A]Ð1L1ɺH5C& ?6HD[]A\A]Ð1Lw1ɺH5& E1 6HD[]A\A]ff.H1sff.SHH* wt [L) 1H5% 5[ff.ATIUHSH dH%(HD$1DÅt.;tIHt;Vx;!ЉEq;HL$dH3 %(H []A\fDHL$ LL$LLD$H5X (;HtD$ T$u T$H5|5 L=HtH@ H@XHt 11LЅu21H5v LI@1H535 LI';|$ wNtAH1ɺH% LkPL 0) H5# 13_AXD|$ .;1ҾLHHX HtwL%>% fDH{?uGH[HtO;tL ( 1ɺ1Ls H5^# Z3L#u ;;;Љ;H( 1ɺPH$ H5" PL ( 1L0' 2Y^+;1;|$f.HL ' L& L$H5x" Q1RP1m2H Oo*ff.@AUATUSHI@@IxLHEHsHHNPHVHHH"LP1ɺuIHHHxHHHrH觖HHHHH@L(H|$0HLLMHlÅt~H[]A\A]@1L% 1ۺqH5F! B1H[]A\A]DLy1ɺx1H5! 1 1H[]A\A]LI1ɺ~1H5 0af.ATIUHSHHdH%(HD$1u&A$HL$dH3 %(ucH[]A\ÐHHT$HÅtD$tA$fDI!1L# H5- )02(fAVAUATIUHH5( SHo1H5( H6HHID$HHxPyIHI$\H5i H6L Z Å|I$`H5[ HL L ÅTfM$HA$I$TH5O AFAF AF0bÅhI$UH5O HAÅI$VH5tO H ÅVLH5N HdL ? ÅA$ I$ H5RO H3L CO ÅyI$$H5 H L ÅQI$WH5MO HÅI$,H5AO H¹L 2O ÅI$4H5O H蚹L O ÅI$0H5 O HrL N ÅI$8H5N HJL N ÅI$<H5N H"L N ÅhI$@H5N HL N Å@I$DH5N HҸL N ÅI$HH5N H誸L N ÅI$LH5N H肸L sN ÅI$PH5nN HZÅH5jN H!ADŽ$X1L1LI,ÅfID$LHHX@3fDL e$ L !H53 11+,[]A\A]A^L M 1L !H5 +[]A\A]A^f.IٹLp f.L 1ɺ1H5 +of.L٭1ɺ1H5s o+?f.L1ɺ1H5C ?+L1ɺ1H5 +L]1ɺ%1H5 *1H5L H-HtI$XH'#L jL c@ATUSHG@HIHH5E LH@HPH1Åt.HH5/ LP1Åtm[]A\Ð1L1ɺnH5# *[]A\11L jH5 )[]A\L)1ɺo1H5 )rf.ATIH5UHSHLH@HPH1\HL L1HÅFHE`H5 LH@PH1[ÅqL)ÅTRUVtH5 L1KÅH5  L1 'Å- H L14 H Å$H5 L1ÅW/H5 L1ÅL1ɺG1H5 (*fLY1ɺ31H5 '[]A\L'11ɺ1H5 '[]A\fDH5 L1ÅLީ1ɺ:1H5x t'fH5 L1Å`L1ɺ<1H58 4'@,H L14 H :Å4H5 L1YÅ0H L14 H Å}8H5 L1Å<H5~ L1Å@H5n L1ÅDH5_ L1ÅHH5O L1ÅLH5E L1kÅPH59 L1JÅX1L1ɺ5H5 %[]A\Lɧ1ɺ@1H5c _%kf.L1ɺ71H53 /%;f.Li1ɺJ1H5 $ f.L91ɺC1H5 $f.L 1ɺ>1H5 $f.L٦1ɺD1H5s o${f.L1ɺL1H5C ?$KL1ɺP1H5 $%L]1ɺQ1H5 #L71ɺR1H5 #L1ɺS1H5 #L1ɺT1H5 #Lť1ɺU1H5_ [#gL1ɺV1H59 5#A H5 LH1ÅKLV1ɺZ1H5 "L01ɺW1H5 "AVIAUIHATUSoHHHTHHHAF HLHC(H HCH"5HC )zAąHG LHE(HHEHF5HE [HE0HtHMHLyAąHu(LK(^1A1ɿL= H5 !XDZ ;[]A\A]A^@1BE1LZ H5u q!HY[D]A\A]A^DH@1L1ɺMH53 /![D]A\A]A^1Lg1ɺ\H5  [D]A\A]A^HHpHHxHHAWIAVIAUIATUSHI}LxM|HHt7LA"HuE&LrH[ID]A\A]A^A_fDAAVHAUATUSHdH%(H$1ILtV_LHtL-81Me)HHLH:t>I(1t I$Hu1H$dH3 %(u#H[]A\A]A^@HcHDAD@AVH@AUATUSHPdH%(HD$H1IL!:LHt,LHtD5;E~CL%;1LDHD9t$H}LuHcHIDfD1HL$HdH3 %(u HP[]A\A]A^@:HA w HstHƹ H=+ t2HcHH\8HHP HtOH5A1@tSt^uADA]tHPH51flfD\fDAWE1AVIAUAATAUHS1H-@I>D tVA t;0LHHEttLtgEt|8fDE uAfE tH5e 1 DHUH51 HUH51 b@E uH[]A\A]A^A_HH5 1[]A\A]A^A_J f.1?-t -tHI1L0O NH5 Z1HAVIAUIATL%8UIl$0SH t,HuL0uHcHAD[]A\A]A^M1LN H5  1]A\A]A^f.AV@AUIATUSH`dH%(H$X1H$Hl$HAHt$ HH߹_|$ ~}E1L%d I0fHTLHtHLHI H9\$ H$XdH3<%(LuH`[]A\A]A^DE1ff.AW|AVAUATIUSH8H|$Ll$ HHt$LdH%(H$(1D$1A-@H5#c L1Ht uAL$ H9l$~wM|LÅLHI $ u_LHtH|$L@ID$H5b LHtAL$ H9l$H$(dH3%(uGH8[]A\A]A^A_1MLL H5 qHD$H0qHL< H PHcH>1VfDH=] Hf1GfDH=F HָtH=  f1ff.fAVE1AUE1ATUH- SHHdH%(H$1ILHHh /fD t \tIcAAtIH; ADH9H3HHt@Et\uAuMcLH5? 1B4|Wf.Eu AE1fMcLH5 1B4B1L繀HH EuH$dH3%(uH[]A\A]A^kff.AW AVAUATUSHXH|$Ld$ Ht$LdH%(HD$H1 H5g L HD$HtE1kD9|8LD)Hc;DLcN|\HL$HT$E1LI6{AtjAfH|$LRfDEtbHDH  HELB PH5 1QR"AM0H HD$(dH3%(uH8[]A\A]A^A_H H`AUIHATUHSHH(dH%(H$1HHHHtVLd$Ht$ HLT$ LHLH$dH3%(ujH(H[]A\A]fM0H$dH3%(u H5. 1 fHH[]A\A]A^A_L-75I HtMLAHà H AGHt.AH;H~I"L> pE1D=5ff.@SHHHDPt H[P1[ff.AWAVAUATUSHHL%w5I$HLd$D$<HD$ HD$D$<HHLt$A uHc;H'II}HuA I5I9uHD$Hcl$HH-HD$HH'H$H|$H H$H$DŽ$E1H$D|$|L$L|$MIHL$0H$:fD$HH|$ LH`IFM9t?IH;EJ,AtH3HT$0A1LHqIFM9uD|$|H$L$H|$HHD$(H54|$@)447Ht$H|$ LE1D$fM1Lb/ H5Z K0HD$ H$H8;HL$HAH)L2~1ɺ8H5 f.E1H$dH3 %(D H[]A\A]A^A_ÐL$EHD$T$HxH8 `T$Hދ>H!ကtωT$DH~HD@HH)LdHD$ LH8T$HH= Lt$HHLLр H1MNSInXZD$DD$u E!H=A LQj@K0DL$EE$H|$LD$D$hD$dD$lXHD|$|H$L$E<HHH HEL- QH5 P1R_HL$HH HrT;L0HYT;HB0H('@H5H9QtD$:E1H5 HHt HD$H0H5 HD$HFHD$H08ML)- vH5 K0)fD$EHD$D5A  HL$AFHE1L$H$5Lҹ LT$8$E1ۅIcHL$LT$8L|$0HD$HEHDl$(LL4*f.AFAID9$`N,H=Lt¹H=LAFA@DT$EuFEtA$Ht$LH|$ hD$D$lD$dD$hH= L^zDL|$pLHAٹD$Ha L+ PH5 1ATH Q;HiD$x5H L0|$E$1DŽ$HHH$HL$uDl$(IL|$0:$IHt$H|$ HEL9%HʼnHuH$LtIuR4AI0AD9~\IcVHIH)HTB HRu1H5b .I>t ^LDHfDD4EHcЋL$H-8HRHLd8pH5 1JH5d L)HDP HH1I|$ub41D4AAI0BD9+Mc<$JML)| tȅrH5 17mf fIT$DH1ɋ4f4Lk@E1H-86fHH5 ¿1I}u_AI0D94EeASIcHH)HTB HRu1H5` iI}t LDH9HcD$HRHLd8hfDH5 1JH5e` L)HT1I|$uj4D41ABI0D9Mc,$J<ML)| uAtTtH5? 1yo@ IT$DH1ɋ4D4wfH;L$L$D$ED$D$D$=:)H5 1 D4:EoDd$E4H4t=H5g 1H4H4HH5X 1lD\$ED4E~L8 E1H-m~8M4AI0D9Mc0JML)| tHj:4~/D;8 tHh HRHH H0D;htH9uH<$tH$ ~FElH5 1LD$JH5 L)HDP HH1YLD$Ix9H5a 1LD$1LD$H58 1 CT$uH{HtH( []A\A]A^A_DH5 14tH5 1E14H)!gAH0D94KH}t H1HH;DD$D$PE1AI0D943Mc7JML)| uHT:4~1D;8 tHh HRHH H0D;htH9uH<$tH$ ~BmH5 1rJH5[ L)HT1OIuH5` 15 fIWDHD FLD$DHIPLD$D$D$4H`(E1fDAH0D94H}t H1H H5< 1h 4fDH5< 15H-^z8H;p+H53 1D$fDAW1AVAUATUSHHt$H5 H-/:4H8 E1L%y8I-H5 14AI0D9IcHIH)I Āy H $tH5j 1AAڅt܋4~098 tȃHh HRHL H09HtH9uA>t1DT$H5 HD$DT$4~qHD$98 tzHh E1AA9tPH09HuAIN 1H5. DT$D\$qLc\$HD$DT$K[HH@ uH5g 1ACL!1H5Hl$0Ht$ HT$(D$@HLR1ɺH5AtHl$0Ht$ HT$(D$@H`LR1ɺH5fA#pL1H5<H=6HH= H H=hHD$@Hl$0Hl$0Ht$ HT$(D$@HzLQ1ɺH5A=Hl$0Ht$ HT$(D$@ H)dLZQ1ɺH5/A9sHHl$0D$@H={HuD$@Hl$0H5gHuD$@Hl$0{)1LH5I@H#HfUHSHHoHE HP1H5 R1ILs!H{PY^.tH{Pqt H[]ÐHHI$PLT1H5\XZ1H[]ÐH HbAU1AATIUHSH]E^t/Et*t u`H[]A\A]fDH0ÅuA$ uH7N@3u A$@uEui1DL˴u1H=tA,t8At2At,L 1H5-HDH߉ft2H$dH3 %(HĐ[]A\f.HhHADHHP tAtAtHCX u@u@uiHHV1H羀HB1LAH5H8@[HELHIHLH= H1L IEfHLUIH51AH{P(cS@u)u [11É[fD ÅuL>F1ɺp1H5)fAWAVAUATUSHdH%(H$1HG(44qIIE1$D$D$ D$#fDIF(A44D9IcLHTRHlYtH$DŽ$H$HH$HH$$H$ H9uI|$PSPD l? |  ID$P1ҾD$H8蓼LCIT$X @T9TL$$fDD$ fD711ALLD$0<L@L!1ɺ!I5f.  |'1Ҿ'LD$xIT$XHH39HH3H3HEƒL$$ID$Xf  DD$:*1ҾLŃvID$PH@H@@Yt EvEA߉1A AA9HD SL,1ɺH51ET_AXE;|$p*DAl$pLH1PA1L~H5b L$D$XZ@=?ID$PLD$HJAGHH=HZED 9E@ L1H5ʮuLLD$4$@_G yzID$PLD$L8@LHL%LЦD$$ HcID$PHHxOHD$HIo@IG@1HD$H9Dl$(AH\$8Lt$03HM1HH S腸AHmH;l$wH]Hat1ҾHNIHHHL$IIcHID$PIvHxHHsI^C|5:RLHbGDLl7IH5ج1聽@L$tZ$L?1ɺL1H5DH$dH3 %(H[]A\A]A^A_D|$ ED$D$ H1If.HcLHTRHDlDH H$H$H'H$HH$HH$HG=H$H_DH$H H$H L$H$AH$DHA9uI|$PrI A AAA$qեyLTIH5Ū1nE1ҋ4$tTL$ tLLDT$I1M~LH5x@11D$ DT$DL IF(449L$$D$9v n I|$PYtAuoLD$D$`1H=GL4 1ɿH5!ѝH[]AL 1ɿH5衝kAW1H AVIAUATUSHH8dH%(HD$(1AHLd$LHzHAŅG"AǃHLc1L=E%HmHI'HHH{PHL$H# AVHL$HL HDQELAWLDH5΋1Po1tHEH HPHCXuHH%H*HCX 1HH4@HEHH@PHx蛶IHgHEHpMLthHHx1Hu%qH4RHHH|2HQM<6D$ILLD$;ELrfH5HaYEHCPHH8aL1ɺH5jD1IHLVD.fH裷#Lu!H2H=H1 L{LL;Ht$(LŅwHT$$Ht$0LmŅLdHt$(LLdSLLE1҅'H{PL9X^L$ 1LHKHH|$1H[cH{PHT$Ht$ H;LHt$(HHt$(LL73LLH.HT$Ht$(1LP;H{PMH{P(H|$(lL%{1ɺ IH5]1uL0H4L{1ɺ IH5%1uADLy2 Lx$ H5ֱHuE1w$MOHLuD H51uD$CAHD$(LdyJ H5YLHH1tL$0g L IoH|$($ Z L IIH|$(1Lny` IH5հ1@tT$$H߉$謎LxIPT$H51RQ tZYL$oLtm IL!1ɺ| H5GsLKHLu1 H5!sE1kHLJXLIwX(hH{P$L1ɺ LL$Lu H5$sE1S$Lb1ɺ $LL1ɺ L91ɺ $L#1ɺ XAUH- IATUHSH(HNHdH%(H$1H\$H_LxxKL$H}PHLHtHHT$ L15fÃtNLwH511rH$dH34%(|H([]A\A]ÐL$ HL1^Lx1LHLHuL1ۺH5 xqk~iff.AWAVAUATIUSH(WTHt$HvPHHD$"jL YD$ YHct$ I|$H莋LG1ɺgIHI\$@Ml$@1I9t]LsjLZt=1ҾjLfH#I|$HDuI,΍HEHAIcHL9uHD$I|$E1LT$ HpPyHHuL0XHL$H|$Hډ"¸H([]A\A]A^A_fDHGXHE1HHHD$HL,1ɺ_H5RoDL1ɺdH5'oH([]A\A]A^A_DL|unH5^oH([]A\A]A^A_f.L1ɺrH5!oH([]A\A]A^A_LV1ɺy1H5nH([]A\A]A^A_L!1ɺvAWAVAUATUHSHHdH%(HD$1HGXH~PHH$d- HCPHHH&L,$H҈H{HLIcftWHmhAč@=wAD$DLt1H5m)@MLItH5Vm1L 1ɺH55mDHL$dH3 %(!H[]A\A]A^A_DHCPLsH5ݩL1Amf.H{PD&DH蛉L@e 1ɺIH5|1lH{PLIH7H/LwHL&Ls+IH51lf.L1ɺH5ߨQlL1ɺH5!lY@11M0LmsH5k1H5t1Ls1kHSuLH=sHHEXHu)Hx$H-HHtzf.AwWDHਸtHHBMtI]H.H LNqSI1H51hXZH[]A\A]ÐHLYIH5֤1AhH\DHEX"ff.AWAVAUATIUSHHHnPdH%(H$1H&1Ҿ\LOUHD$ HHT$ HL]Ht$ H8HHDH9HL{PLsX胾Aʼn9yAUA HHtHXH誁HH5SIL_pC 1f^_1LC1ɺH5nffDH$dH3 %(uH[]A\A]A^A_H!HEY@NuHEXHHՀLoX IH5â1.f-fHCPyLnL1H5eHXLnIfUJI%I-HڧL HKHALl$0LDHJ 1LRHLIsMt91ҾLp_AA;FTtHD$GDT$EVTLLu3HmHHD$`HT$H=oH1L0pH|$1fL^ fIH51K;$HPDL$L]1H5NKZYC@AVAUATUSHHdH%(H$1HHIHIHI1HIH Lv8H} eHH$H}LXhHCHto/HAHCHtYH}L-hHHtEH}LhHCHt0HCH$dH3 %(HHĐ[]A\A]A^ÐL]1DH5|JH}H1e@L\11ۺ2H5ՆBJrDH71MSL\1۹H5 JXZ8L\1<H5oI AfATIUH SHHdHHHEPHUHI|$HHHCHHEXHu.S 1҈Cu,C҃ ЈCH[]A\fDHHpH@HPH LI\1DH5HfI|$H1cL*11JH5SHeff.AVIAUAATIUSDuqtMMH8HH 8L+HDȸHD[D]LA\A]A^ fML@H 8[]A\A]A^fH0USHHGXu H[]@HHHX(YbE\ L ri zSL![H5>PH> LD11GXZE\uHHHxaL[IH51TGHHaLZIH51GH[]SHZ2HtH{HA [L)1ɺ[H5OF[f.IH=wd L€t H=[( Lff.IH=8G L€tH=B Lff.UHHSHFtH[]fHV`LB7LIH5D1EH[]fDAUIHATUSHHHnP`HIe=H@[H3sH{t*HbL -uH_1ɿLYIFH5y1DHHQ_HY1IٺKLYH58@11ɃDH[]A\A]M,1LXH5aD1L1ɺH5Ӏ@DH[]A\A]MLX'H5 DfLI1ɺIH5oC{@LL"X12H5@CGL+vHfH3yVH]H=WH1袍HLݣ DD$8EHL輣YLL詣j IFHHT$(1LLHD$8 H|$8MH@ H@ HD1`HD$(H Ht$(HE11ALNXjjjjjQjjjH|$`^6HD$`HPH* Ht$(HHt$VHt$(H|$AIHLɒ Lj IdžHǃT IH5 H0 HD$(H5*HHt$T$t$VT$$Hdžu HD$(HHXt$xH|$(t 'L/  1Ҿ'L(2t HD$(HhX3H$tHT$ 1HL H|$HG $LHT$eo L L5 E ߍH5s LuQt$XLL$1Ƀ1!7^A_HT$0HtYD$L LLH$AVjLD$(HA_ZD$ LD$HT$0HLLD$D$HT$@Ht\D$H$L LWHLjLD$XAXAYD$ LD$HHT$@HLLD$7D$H$HD$ƽD$wD$! L$LLsH5r15D$:HD$@HD$HHLt$`t$`ARH$PH$PSH$PHL$PbH@[$Lܷ1ɺ H5r1r5D$L$& L@sLHT$|LL$H$L$L$UL$x$LY1ɺh xH$H_D$p^ZO9 LJID$L1ɺd %H߉$O? L, IzH1ɺ H)rL` PHrLaMPH5p1ARLL$ C4H L"L` LT$PH4$1H=<\~2 LHH5n@111E1$ LHH5m1T1D$HDL$$KDL$LGH5mAQT$I1R 1A[E1[HkX*HL fHsX*L)$DŽ$L牄$HDŽ$$$$$$@H }$LG HmHPHnL P1ɺ ARLL$ LI1H5l0H L LT$PQH1ɺ HmL=\ PHr LHPH59l1ARLL$ /H L \ LT$PgLL$AL$D$p$L1ɺ~ L$IL%G IH5k1'/D$H߉$ILT: ILH1ɺ H5nk.HlVPH~ $LE H&$L1ɺ HGlRPH7 Ll H5j_.E1L$L$$T$|t$tH|$fiE$Ld1ɺL $LN1ɺ0 mL;1ɺ( H5aj-E1{1H  HLH5 H%HD$(H5 HL1ɺr :IUXL_R$L1ɺV $Lj1ɺg $LT1ɺo s$L>1ɺj ]MAR t$8L~EH5Ci,A[]D$MR t$HH5iLbE},Y^D$PHjPHj.Ht$(H LtCHt$(LOAÅH|$(D$FL$D| IH5h1+HD$LHHp蹕D$HD$LD$H蕕D$HD$HFLD IH5h1s+E1RH5 H|#HD$(H5 HHD$HHxELhC IH5g1+D$,H|$($lELiu IH5\g1*D$ff.AUATUHSHHHG(@$'t7LC1H5fc*1H[]A\A]@E1AHuPSTLDHEDHHuL[1ɿH5f)됐HCXH{E1HHIHuL11H5Cf)EfDAE1KfAWAVAUIATUHHSHH荀AHE(@%*(QHCXH0AE1ADHuJ lEHH߅1HKX@HsPUTLH H\HmHLHH[]A\A]A^A_aHةHHxxAADL%T :Ly1ɺC^AAE11LAH5od'H[]A\A]A^A_EL1ɺ1H5)d'DL%T g9EH LD7L1ɺH5c1O'DL%Ӓ 9H-HtHhHAATL@UI1H5c&XZH[]A\A]A^A_HEXH}E1HHIHHKX@HEDHH,¸L֨1ɺ1H5bl&f@LR@I1H5b4&H[]A\A]A^A_ùLT@H5b%@Hh@L IfHH@LcIhL1ɺff.AW1AVAUATUHSHHHLnPdH%(HD$81HD$ HHT$ IHe^Ht$ LѤIHm1Hl HH1!AD$] I$H H u!L*?H=C@H1nHL>SI1H5`#XZ@HL$8dH3 %(HH[]A\A]A^A_DAD$^dL9HM1HALL~HL`HCXH%@HoLD$HD$08HL$HT$HHt$LL$0LD$(B=H{P蔰HL?HH-T$L|$0HLt$(Dl$Dd$T$ !T$ MMDDH]iHI H|$0HtH 1( H5dVg@L1ɺ H57V?@L1ɺ H5Vk@1ɺ H5ULYHLL+LLtYL蜚H Le1ɺ" 1H5UfDLvL61 H5JUML1ɺ 1H5$UIAV1AUATUHSHH LnPdH%(HD$1HD$HtHT$IHX(Ht$L×IH@\ C^uGLHH)¸BHL$dH3 %(RH []A\A]A^fHH LHt$ H7D$ wH1L6YIH5S1?2f.HHnAƉ(AVv A L9RE1MHLHuHt$L耖IH5@\ H21ALi5IfD1H5SH%HH0HLM5UIH5RN19ZHY0Lc5PIH5R1$fDLA1ɺH5gRL1ɺH57RL1ɺa1H5 RwjfHHtHXL/HH5QSIL=31+,^_FLL$LSmDLx/7LW3IGL!1ɺUH5GQ@H(/1L2ILL$<L3 ff.@AUf1ATUHcSHHXdH%(HD$H1I)$)D$)D$ )D$0LHrbH&V1ҾaH HHEX1H HH߷_E\HmH.H j1IٺLz3H5O@11ɃSf1H HHLmPXsTIHMXH 1LHerHU-H]i1IٺL2H5HHL[1ɺfLI1ɺ1H5rNyDL1ɺLcP1H5/N6fLٓ1ɺH5Mq L1DL1ɺH5M)* f.AWAVIAUMn@ATUSHHHt$H|$pHT$1HL$(8dH%(H$81H|$ HHLHDŽ$DŽ$H$HƄ$DŽ$H$XHDŽ$`DŽ$x I^@H$L9H- E1HD$-H<$AIcAHl0HL9L{Lt1ҾLHH8@tIHL|NH9H|$H&HOH<$mH@HD$LHI L|$A)1AL;0H5K1@H$HL$HHEH $ESI~Ht$HL$0DAHHHD$H$0HMHH1&L,0H|$H/HtuL$1LHWMHHHHD$LH1l.L/;H|$HL\HvHD$1H4$LH$H$H$XH$,^*HI1PL/<1H58J XZHD$ HgH5r L3H$ HHt$ H|$!HHL$(HxLL)HH=-H1yWf.H!bL"I1H5CQH$dH3 %(H[]A\A]A^A_Li1ɺ H5C1LH1ɺH5sCL"1ɺH5ECH|$8Ht8fDL1ɺZH5C+H؇HHhH L"1ɺIH5B11@Lq1ɺzH5B H|$ n gLEIqDL1ɺH5?B[L1ɺ DHD$E1L1ɺ}H5AQL1ɺrH5A!LLW'I H5qA1H|$8H&fDL1ɺ DLL$(LA]H5A31Ҿ]H)HT11LM H5@?1H5@1L` HJH= MNLHHLnLIcHkX1I麌L'H5J>@H11ATAZA[MfDHLLhLq'H5=1GfH-sHE(@H{P跎HLI|H1ɺAUI1L(H5e=^_H{PGL(OH$Ll$pIt$HH LgLLm 1ɺIH5<1QH{PH{PLHHHV1IمL%H5<@H11UZYfDMuM~LZfHt$ HHT$)D$ )D$0)D$@)D$P)D$`).H{P(H85D$ AD$[D$ |$hy D$PHD$ uHHFh 1HHE U1L#H5v;@11HQ's1HHEHHӴHh AL$  HM(AyuAHLXDHE(xHZFL#H5HPB 'HXMHLhfL=IL=H54:@L##fHcHN1H591L 5HHsDHHS1Iٺ;LP"H5j9@11l@L"SfIEQ1LHV;L~1ɺH58\H}IHHxG[ M$L}HH@@[I$n}H@[C[I$F}LtfHH0I$I}L H1ɺAVI1L"H57kAXAYHJ#H1LŃ*I9HHQ1IٺL"H57@11AfL9}1ɺH5_7HLHҞÅ1LH[à LLIHQ1I麆LH56@H11ATE]A\DL|1ɺH561\DLQ|1ɺ8H5w6.L!|1ɺH5G61LLHX?L{1ɺH55lI$zHHxL1ɺIH551f.1IIL/1H5r5I$I$3zH7LX1ɺIH5(51fDLLI1ɺIH541\HLe1ɺIH5410L35f.LYz1ɺN1LOH5j4@11D$ HHaLy1ɺ2H5!4nN1H54Lz@11b1@HLILH=H1ALA4EHEE^H@HHEt}Lt IV:H=5 HHH= HֹH=@ €[AQ}A~dMu uAN`Av,DHDT$eDT$HDT$"gtFDT$Eu AF`&HAH@1IٺLH5&@11L0l1ɺ1H5Y&L l1ɺH50&nLiIF \Lk1ɺH5%\(bfAWf1AVAUATUHSHHhLfPdH%(H$X1)D$`)D$p)$)$)$D$,tHD$8HHT$8I$H)Ht$8L\hHD$0H L(H9tH@^iH@@tH|$0ixLH|$0 LIH5$1H$XdH3 %( Hh[]A\A]A^A_HL$0HUHLH,HLt$,Ht$`LHADELHHuD$,H5VV H='D$HD$0LHD$HD$@IH4L$LLLD$LD$Ht. LH=&uHT$@H5&LLLt$@I |$;|$KML IE1*H|$0&L IDLL$8L H5TL`1ɺ^H5iL| BH5^HH.H(L`1ɺDH5'fH|$0xL= IDHHGL.`1ɺQH5TL8L IH5&1L_1ɺ`H5hEHWL I L_1ɺ|H5HM$L t$H5uXZ1H5`L_LHF fL^1ɺH5L^1ɺH5]bcAWAVIHAUATUSHHHLjdH%(HD$81\HHI蘖HH@XDEML|$E11ALHLID$H@ H@XHt1LLЅ3H{P*iH:jLHgH8HEP1H s HHxn.HHHH11IمLH5@H11UXZHI|$HHI=HH2ATL< IUp5fHHHHL5UI~H51QAXAYL\1ɺ1H5,HL$8dH3 %(HH[]A\A]A^A_@|$=t$(1Ht$ H[t |$ HDLIH521KL[1ɺH5q@L[1ɺg1H5GfHHHHLIUw1H1Hro/1LA @1Ƀ1H5FLH譔H{P$tH{PgYLZ1ɺ1H5nfLH5>f.1L@1ɃGDE1E11LHLtL$uZq.1LH5S@11DLY1ɺH5?HH .1IٺL<H5@11RHLwHHtI}1AMLpY1ɺff.@ATIUHHSH׏uCC\uHZt []A\HHvu[]A\LHH[]A\>ff.AWAAVAUATIHUHSHH(DD$ LL$WHIH߉D$MJ}hD$u CY9H{PPM`H IAHCPE1L狰AƅDH=HHCXĀfD9|$KLDoHgH߉D$DT$HCZ@DD$ HL$HHLLItHLvbMpDE+T$jHLPt$ jDEt&H D$ TH[VHHHhHnDT$ trHDT$  DT$ tHLDT$ >DT$ tCHDT$ Hu LՇÅHID$XHHH@HuH=k Àۅu#L贷EEhLLlCAID$PLMtH=_ LDuEu D]EElDuh3ADuhA)E(A9t0ML$HL11DT$H5> DT$AD$Yt }dHE AECuutm1҅HLDT$dA&1LBIH5 16LYDT$LAD$YE9v A9A9 E9LEDHLLUÅSM\L8H@$1IٺL @H5 11@M|Hu>oH= L CH5 11(DL_O1ɺH5 1H[]A\A]A^A_@H&L H:LDH1HG L= PH5& 1XZfD}EEd]hAzDjL 1H56L LiN1ɺ1H5f.E9AD$YI$DT$'DT$LL "IH5 1uL1LJ IH51?Ef.H!1IٺL @H511ADuh@D)AƉEh@AL 1H5)LL1ɺ1H51syfD1ҾLL 1H5-3U`LDT$ T$|KT$DT$ ;'L 1H5f8fDD9EhHAt$HA1L& H5AXAYLK1ɺ1H5W]fLDT$JID$Pu`H8L 1ɺIH51 DT$gL H5d;AVL5+ AUATIUHSH9IEHC LuKuIE@t'HC H@ H@XHt1HLЅ0HsLDu0LKL脁u LȁuSu C tsfDL3Hs HKtHSpLLK|LCx/?LKLu L_tzLޯuCpHEXH0rx@HHHHhHH1HLH÷ IkHs>L}HC HKHsHHHHhHEX@qH1wH <IE@uHp(H=b 1ҾL耀IHC8tH=q H€HƹLL莮MGLLLVHC H@u HH[]A\A]A^f.HHGHpHs LH1ɺH57[]A\A]A^LG1ɺH5y[]A\A]A^þL莭M7/H= L!f.HC LS LH(1H5[]A\A]A^L/G1ɺH5U1L H5,HHLQ~L蟬uܾuL莬u˾HL}uLluHsH=9` tHC @HLf IHfL IHELILϫuL身yHC H@hĀ_HCH=? H€H5; 譣讛ff.AWfAVAUATIUSH8dH%(HD$(1Ll$)D$HD$ MuL1LHD$HL|$Mo2HIT$X1A$H[E1LPAjAWH ߉SD$tbH\$L9tXfLL{Au#@MDLLR H n7=7H9IELH9uHt$L}HL$(dH3 %(u1M麹L H5 @11脙AfLHE8L1ɺH5 >$L% LA  DAV1AUATUHSHdH%(H$1HHLHHD$DŽ$L$L$UH HXHHI}HHUXE1Hi1ɾPH.AHPAU H AH$L9t=fDKD$X1HHsAȃAA@OHA9DLL9uLHH$dH3<%(DuoH[]A\A]A^L1ɺ*H5 A苗fL1 1"H5 AV{\ff.AT1USHHdH%(H$1HIHI$HD$DŽ$H$H$HL`LHHtiHHE11PHPHSXHPAUX H AHHH$dH3%(DuoH[]A\@L1ɺ{H5 A+fL 1rH5 A{ff.HH=E11PHWXAHOPj} H(AT1USHHdH%(H$1HIHI$HD$DŽ$H$H$HL`LHHMtiHHE11PHSXAjHU H AHHH$dH3%(DuuH[]A\f.L1ɺH5 A苔fL1 1H5 AVu\ff.HHG HWXE1wTA1Ɂ`H4ED$L)Euz蕤Il$HI襣AU1ɺUILa H58 1ZYD$t  DHT$dH3%(H[]A\A]@HIl$I+H3AU1H5 UIL @Ǻ11v^_sHL! 麚I1H5y <1RDH訢L IfH舢L Iff.fSHdH%(HD$1HD$t(HHt$H蕸tiHAT$9uHL$dH3 %(ucH[fHL IH5 1A1DL 1ɺH5Q 1 HtkATUHSL'HMt LuH][]A\HM+1SL: H5 謆X1Z[]A\f.AWL=n AVAAUE1ATLUHLSHHHHT$LD$dH%(HD$81HǃnH nHDHCDLHnH01L)HH@ D;EXH)ĄDH;HD;H@EuHH4 u D{E 苑 HH@ H@XHH1HAHEH@ tLث tJ@tLGt) tL H5 1E1EjAHhA1hH5I hhhhhhj^j]j[jFhhhhhhhjUjNhhjKjDj2j.hj#j"hhhj jhhlH01LpH5 1E1RHL$8dH3 %(DpHH[]A\A]A^A_@1ҾHmIH C$HƹH= E1AŅH LDH1H5 %jL1ɺ7H@jA HhA1hH5 hhhhjFhhjSjHhhhhhhhjUjNhhjKjDj2j.hj#j"hh{jH1L+fH@[jAGHjb=A1jcH5W jahH 1ɺLHAH1jAhH5 hhH 1ɺLo#fLY1ɺDHtHCf1Ҿ9HAg CC 1ҾL{HH.kHSPLHHCP諿 1ҾHkH{HC`HS`LHHHPH E6H{`5H{HgLC`HL{PH@HMt3LLHL$ LD$uLD$HL$ wL{`HCPH{HHA=H1jAhH5 hhhhjGwH@D jAA1hHhH5y hsH ADž 1ҾHvHL$HHA(dH d1ҾH v1HxHL$HAHKtHSpHLLڗz{Ht5HHCHHF`t;HHsxHHLL?HH@H)sML 1HPHLLD$xLD$O1LHHH@A@u/A?@u"uHH!HEAA>HDL$bDL$8H1HAƒ tSpD9KD;SHbCtHHHP1ҾHsC|xHHPƀNEt {ptru HD$H8t]HsPCxPH辕L 1ɺIH5B 1 y1ҾHo Hǃs)Lm@HE@HD$ L9tifDIMHHL$bt>HL$1ҾHnHH}HLHD$%KLL$HMmL;l$ uH@HD$HL$ADp HHML 1E1=H5 wf1ɺ:E1LH5 wgfjAA 1hHhH5a hhhj'hjj$hhhhj^j]j[jFhhhhhhhjUjNhhjKjDj2j.hj#j"hhbH0ADžH _uH^( [H^CH^KGS$` L 1*H5 XvH5ߛ H,HHH@HS^H>^tsE1L=# LA1ɺ}DHlC fDL 1H5 uEH]xfH]E1L=k@L1ɺD'Hc]}HL# H58 LH(1t1HH5 E_+ HH@DL1ɺ1H5 t@fLXH)EHD$1HH0wv/HHD$0HD$jHT$H4 L 1H5D tfDLQ1ɺDHA H1jAhH5 hjj$hhhhj^j]j[hhhhhhjUjNhhjKjDj2j.hj#j"hh^H1LAǺ:HCH@AH1SH5< _]ADž1ҾHiyL6 1jH5 rR@HZHZL H5 TrH1H5ڷ \Lv1ɺsf1A$HAH5 Y\HH@ijAA 1hHhH5 hhhjjhhhhhjFhhhhhhhjUjNhhjKjDj2j.hj#j"hh\HADžH4YuH#Y[HYLߴ 1UH5 p[DLѳ 1H5 p-L1ɺ=H5 YpL@C @HH@f.Li1ɺ1H55 of.L91ɺguDE H{H?LC`E1HL{PMMfHW;HH@L1ɺ1H5} Go:fkWgDHExFn1L0 H5% nML{PMLLfMLG H5 n@HVHV*E1L=ښ nL1ɺCH5j 9n,@Ly1ɺPLH(LZ8 1H5+ m1ҾHq[Hm1ҾHY[YLͱ 1H5 mIjAA^1h][Hj'H5 j$hhhhWH@L1ɺ 1H5^ (mL 1<H55 lHD$1HH0o/HHD$0HD$qcHT$HaHSXLHSXHpHS`LKXHCLHLL$ HT$dHT$LL$ HCXHD$AH{HLC`MH$H]THHQL^1ɺD1H5* kLKHL H5 kHD$1HH0m/HHD$0HD$;bHgHT$0LHBAHS`LD$0Ht'HLHT$ LD$wcLD$HT$ dH{HLC`HHD$AHQ_L &H5+ jL 1H5 j1H}eHL$HHAL1ɺy1H5 j*EHD$HSXLHHHCX;H{HHHD$ALC`HQjjAA1hHhH5 hhhUTH0^L"1ɺ^1H5 ia1HIrLHH{H8L\ 1~H5 giZHLGL1ɺ]H5a 0i#DHT$EHLALC`HLL41ɺH5 hH<EAxALLǯ 1H5 h}1HqHCHHHHQLI(APAWL- H5j 12hAYAZ!D;Kp(L ARq(H5+ 1g_AXL1 1UH5 gL1ɺ1H5ܿ gL 1H5 }gpL1ɺH5 YgLLK`CHgOHRO,E1L= 1ҾHL!1ɺzH5 dDL$)Lb H5 11udHDL$HA81Lj H5o >dL1ɺH5K d L^1ɺH5' cL:1ɺ1H5 c[L1ɺH5ػ c1Lԯ H5 c)1HlLHVLH{HLHLU H5b LH(1&cLR ASq(1Lb H5 bHLH(RAPL z1HUkLHlH{HR1L1 H5 ubhHHcLH(1L 1ɺ!H5Y #bCpHmE1L H5 a1L H5 aoD1L Sq(A1L H5 }a&1L H5 VaI1ҾaHBXǃXbHSI>cH>I1ҾcHNHhH蘿ADžL&1ɺ1H5 `e1ҾGHZ1Ҿ=H艃Z艃;yCt9C|H|s|HHD$(|HD$ HLH(LL$ͶHL$(H5] L* QHT$(11RLL$(K`CtC|Y^jOLH(1LF 1ɺ)H5 _CpH LI(L: 1|H5 _zLH(01L H5 \_L1ɺ1H5q ;_.L1ɺH5H _ L[1ɺH5$ ^HGHFHF1ҾHE1mILH(1L 1ɺH5 c^CpH1L H5_ .^Lw11H5C  ^\LH(1L H5 ]x1ҾHXuaE1L=^ LH(81Le H5µ ]+1Lq H5 e]HWH1E1ƔI:1Lu H5: ]D1LT H5 \1ҾbHSt%1L H5Ҵ \@ff.AUIATIUHSHZHHxHPHu(HU`Ht ]H[]A\A]fHu`Ht* nMtHu`LHHH@HH)uMtLDtL0 fH][1jA$A^H5U EAYAZHHxHPH]Hu`!HthMLHHHR tv@] upHuL *IH5! 1Z@]L 1H5 Zm@[@\ QH uL /IH5 1fZ"HLH(1RL H5d 3Z_AXH[]A\A]H}L6 H5) 11Yf.L)1ɺ1H5 Y{f.HhÅL1ɺ1H5 }Y9H}!KHE`HEPHA$11LM`H5\ L YY^HLM`A$%Lߦ H5 XXZf.AWAVAUATUHSHHHLXdH%(H$81HAL8L`1ҾHAR'HAG4@IBAXHuRA@wD1 xHEIOIWHHpH@[H?tAO, H?`EETIHH 07trIu EEMAwuPjH} hAA1H5 AZY7AD$ f.LHHrJIH@H)s E7E)AW,H/M H5 H=İ AW4HEttHǃuH=L H MGXL L AH IEM}L L H | Lt$0VWLP1RH hCH |$0u I@@tn1ҾH MH߉LtDI@@MLp(l1Lè iMH5 @11UIGI4$H%It$H_AT$ EL$HIAH JcH>@IwXHHHZ EE~I<$sIw`HHH"@\ L( 1~H5 TH}H56 k IH AA9HE1QL6J 1ɺH5 ^TA^XFfDEt$ E荽HM HHHL$HD$M<HL$H9D$ I1HJ AGp1AAGpEL 1H5ޫ S31ҾH5@AO,1ҾHlJAO,f. H>JEAG0E~DLa1ɺH5* RLB11H5 RMuHXHt1H}H$8dH3%(HH[]A\A]A^A_1Ҿ'HLADIw`HHEHHD$IH~@] ,H|$M:LBhm H|$&:tII3FXdH1jH|$AAH5t <ZYLIAG4SHSH|$LIGPIGIG`IHHEE ALТ 1H5! PL11ɺ1H5 PfA(DL1ɺH5¨ P@IGPIG`H}AL1ɺH5l ;PfDH}AL[1ɺ H5$ OfDMLDHEIL$AHHxIHEL$A> H 7 JcH>DH\A2@1Ҿ;HH9D$8 IHJ=1Ewp(f.L H5 N4fPAwptBt<A9v)Awpf. < Lğ 1H5 wNL1ɺ1H5 ONrf.L 1;H5R NLe1ɺ1H51 M1D@@\ IHBg Lz 1sH5 MDL1ɺ1H5 MfH9T$_IHJmA1҉ƉD$nAE1A|$ALJE AttA9 D1A@IAWpL$,L\$ Hp(T$Ht$*gHt$EL VT$H5פ RL$ wIH5s 1;AA;H[L mIH54 1@OL@1ɺH5 @L1ɺH5 @H|$L肪IL[L >IH5 1k@H|$LyLZLM 9IH5Z 1"@1Lg H5/ ?13L;1ɺH5 ?UH}HI\H}HD$AH*\HD$ 1L H5 @H11HT$RLL$nZ?EXZHHIHAwxt$DL$讕1{L @H11t$VDL$H5 >E_E)AYAZEAD$^L 1H5ٖ >^L1ɺH5 >L 1H5 V>Lz 1_H5c ->H|$LkLLX1L -IH5 1=IHHGHMO`H5 gL =^_MOX21Li H5 x=3L1ɺH5 T=LWLK 3IH5X 1 =MOXL 1eH5+ <4ff.AUATIUHSHHHAL(thIuPL\IHt,HHHFSÃtWH[]A\A]DMMP+1L H5 P-f.@UHSHH6u HJtHtHYH[]Ð1HH#[HtHZsH[]ff.ATIUSHtZHuH,L '1H5 (4[]A\fDH; H&MHHqHusHubHuQHtHu`HHDE11PE1LjHjH L! 4f.LH[]A\L 9fgHHH2H8*ff.AUATIUHSHH_G,<+<-G(%HHDPuH1[]A\A]) LHI+I9$tAUuH=vtEH9vfHEH9vSHHE HUH[]A\A]G(HMG(H5EEHDH|~zt:~Ht0t#Ef.f.t踢tہt~1Htc~Agttt`uڹH=/ H%@=wGEÐf.H=ff.AWyAVAUAATE1USHH3dH%(H$1H|$ H|$HHcHD$Hi H,DEnE96DH ߄9HD)F4"IcLJ#H1ɿH\$1IL H5 s:, _AXDOt$E1E1H29Dt$ N4;HI>!$udAF0u\tt$ tPAFENAvM1ɺPH5 1+H=29ZYL?Hu29N$;I5I'uMH\$LHILHHD$uD$tHYMH([]A\A]A^A_1L 1ɺ+H5_ +H([]A\A]A^A_I1ɺL H5$ *H(1[]A\A]A^A_I1LG H5 *H(1[]A\A]A^A_DAWAVAUATUSHH $HH $HdH%(H$ 1IHI-I-HID$8HWI|$ HH$Ht$ L 091Ht$IH$YILRAzt7DZ IHFLE1EAƒDVDR EAEH FH9~WLcT JLL)IDR EtEZ tA@:IyDH$Ht$ Ht$IH$HA3H Af)HHTA31)FID$@HD$fDHL$H$E1IuA>ADžA?AD$PI|$HJ<L r/9Hp LT$HL9Hc>HIH)I,E uA9uELM|$8E$IMǨteHtBtttE(9CsBI|$-LD$ELD$HHE(H|$HLD$C4LD$AN|At E$AHcu t:H.@3HHH 6IGHLLHP`AAxHL E1AWH5 C'_E1AXH$ dH3%(DHĨ []A\A]A^A_ÐHA?3AA)H/?3HcHIEf.E1Lć H5 &E1qL H5ҁ &E1GHUE HH w L HL RH5 QP12&H E1$LMH H>3L H5= 01%XZD$LԆ 1H5 %E1zH  IFuH  HI+H  H@SHQ{,{x}vv[%fDATAUL S1HdH%(H$1HH,1H1y4Hu+9H$dH3 %(H[]A\fDH5<+9AHc؅xsDt8#<$IH  HHDHLPHJH5g P1R $H Cc8<$IH P HHDH1۹PH>L[PH5~ 1R #H +AVIAUMATAUSH0dH%(HD$(1}t0t:HD$(dH3%(H0[]A\A]A^@8 tхuH 1HAٹ L~ TH59HHH9Stg*8 bzH-C;3LZ9IH0 1H}H}MDHI~ 1fDH-:3ML9H H}`fD9R7Hu t*L˃ 1ɺn1H54} H!DHff.USHHdH%(HD$1HtH$8tnHhH,$8%t%1HT$dH3%(H[]H5 HtH5 Hu"C,H9C  DH5HiH5 HRH5HGH5dzH0H5HmH5| HVH5|| H?H5H(H5y[Ht&H5HtH5sz Hu`H߉?tL{(L] tUH9C wiK1 QuH[]LQ] 1H5Q \H1[]AL\ D1H5sQ (H1[]L!S DAL|\ f.ATIUSHnHH5 Hot;H5c H\uC[]A\HL[]A\C[]A\ff.@SHt 1{[@HWIIH=? Ht H=Ht1LLDLLff.fLFH=  L€tTH=)< L€t9H= L€t H= LfDLFH=! L€tH= LfLFH=L€tH=% LfLFH=Sq L€H=YL€toH=H L€tTH=K L€t9H=DP L€tH=+P LfLFH= L€H=)L€H= L€H=^ L€H=L€H= L€toH=:L€tT H= L€t9H= L€tH= Lff.fLF H=N L€t9 H=5_L€t H=N Lff.LFH=aN L€ H=^L€to H=/N L€tTH=!N L€t9H=N L€tH= N LfAWAVAUAATUSHH=(8tHD[]A\A]A^A_HH=K9H'13HHAŅHJ9HD9E18H-;2H8IƐN4I~Ef/AAFH2L1= HA9uHHHIF II5IuH HL%Ʈ3I<$I$ 1ۉHŠ 蠾H`u8AL%8fDIF I>HeH@IF(XIcĹKH5I9Hi5LU LLH5I 1Hu8s8@LU 1>H5I j18ff.tHcHH3f1ff.ftHcHH3f1ff.fH5H91HNDH5t99uHcHi5H@1ff.fHH@ L L K H5H HLE11bHS1H5H L :LJ K H`dH%(HD$X1HPHu]PHu|11ɺP L ?T LJ H5 H HT$XdH3%(uhH`[fILCJ 11M H5G |zIL'J 11O H5G L[RfAVAUATUSIՃtRH1AA ID11H?EDH9[D]A\A]A^DHH= H€uH3H8H Ht&@Hà ҾH`Hu1Ay LBI 1 H5F 1ҾmL1H\$/T$A$4fDAf.A4A4~AE;oH z;9Ht$H@LHL1hHHH0D9hH9uE4EM 1fI0A;4E9,$uID$1A4~D$I*E1AH0E;4D9+uHC2bVA~fDIVH= HN H=uHDDAtDAHDADA=uDAGeDAUDA|EDAg5DA%DADADAfDDLH 6H{ HfDD$HDd$xMt9D$&DT$@ED$8Dd$\fo$fo$D$XD$@)$D$`D$D)$D$dD$D$H,@DLHb I|$ H I0A;4DA4~z$ID$1DLH$HH9$.XfHC1DLHD$0jHH9D$0MvD$EaD$@|$8QHcD$8D@D$88f.z!MU1ۉl$0$ALD$D$.D$D$}DA4AH0A9}DDL5u$AA4l$0\$D@HuHH= nHB1ҾHHt/HH1ҾHHt/HH1ҾHbHt/H`H1ҾH8H/H2H@IcHi5H24IF(1H-9 xfDIF(94~cHcLHRHLcX+DSt1EI1ɺQ H5J6 KdHIF8IF(94D$|LAFTHD$pIFXt'LH 8LHm=LuAL>8;L9nAhIF @@BdLVLAo(Ao8AoHAoXAohAoxAoA AIF(PAAwAAA AAAA A%LxrL#%LAO)ALALAdLAtAdžIdžIF @ tA tAA#L 1A菜5LA 1AfLA AIF PЉA? #AA@ AA}LtANLȿtA1ҾLMHt"HƹH=u uA?1ҾMf@LA? LHHHHDM HھLLH% H=E HLD 1ɺ 1A@H51 )LɾrLA A蜾LA AoLA 1A21҅ AL 1A赏H H= H€t"H[QHH€I#L軽tO1Ҿ#LHH8GH;8I>HIHEMLi/"LLtIHt 8I^@AI9JL=]-LHpHt HL0HL9Hk"HþtH1Ҿ"HHtHǾ,I~HuHL'uLF 17 H5/ ?LV1ɺ 1H5b/ ML%LL yL#pLvrHHU[LXrLKrILHǀa1I d MNL2 11 H5. [LAo(Ao8AoHAoXAohAAoxAoAAAAAA\L-I~G$7L$Lt$Dȃ!9L$TD$9ND$TD$PAOĉD$PA`}DA4Y1I A uCIcHHi5H@HHHu2D HX H9H0zЂtfDD$DDd$PD$LD$D$TfDA RL軹t AdžL蟹t:H LI1ɺHaIH# LTtAUL;t AdžL:L LvL\LҸBgL踸(|L螸L脸GLj=LPL6IFH= H€|HƹH=eLA H$LÅ $!MN1ɺ L. H5* 1<1L. AH5`* 1 IL b L- HH5+* LE111H5* 1L- L߶ <Lʶ L赶 L蠶ZAtIF @i -LsPLA AJIN LA ЉAA@E1AZŃ    1ۃ }LȵAdLA фADD薵EA IF @@ 1Ҿ&LV'LA 1AنIH HHHƹH" Hg9 MHǹL AH1ɺ PL= 1H5' Y1^L%Hx) IF @@. IF(HH HT$pLt$|H Q{@LIF @@1ҾL&LKL$AIF @@LV{LM1ɺu H5& DL裳H= H~ H=HzA|f1H5&) H=) fDH` L|HD$(tLuiLHeiIH Hǂ!Lb LL1ɺ H5% {LL1ɺ H5% MyL6 6 H5l% !AIF(L.< H53% L1^L'L1ɺ H5% Hݱ[HȱFH= H1fDI~aLK1ɺ 1H5$ 9eLp5  H5X$  "L+-0AH%LڿALAu H=d HL07 1 H5# s6OL葰OLÅL$`9L$@L$d9L$DDHCItDL$HE=t$X:Hc\$\H"9Hi54<HHcH IHHH "9(Hi5Hl"9H e"9HL,5H$H$L$HIl$XfDAE8txI}uqI}ujAU4tIuE11L tMAE8IuMLL$t A}0 D$EtA}0 I@;5mH$Hi5H#21ɺCLKLf4 H5! PD$dP1I~HSH3AXAYHL$ 1& H5! ELH1ɺ H5g! !H| IH= H€KIL4 11 H5! I"LH1ɺ 1H5 Hi5H V 914t&JHcH IHHH53 9*HL$L M…HL$HAHTHH9LMu\LOG1ɺq gL3 ) H5 @<LI~1҉LF1ɺ 1H5 lL3 1ɺ 1H5 ]1ɺ_ Mf@LFH5{ 0LbHtHKL2 1g H58 sL,F1ɺn H5  JH=omLH-0 LH€L4 1ɺ 1H5 YIAL >ADL=L^E1ɺ H5< AL3 11 H5 1AL2 1ɺ 1H5 AL63 11 H5 1rH>IL/ H5 16IF(1ҾL5IF(xlXAPLg7L{6H= HH93B3LZ3%4>Lq2 1ɺ 1H5 o%P(0Ly0 12 H5  }ML\) fLXD$D$D$D$wLA@LHHLH,R`L}IFaH=D ,,b@STD؉[DAWIAVE1AUIATAUHSHfA]HfIA]HDA u#'tn"ti1IELu8tHHt uDA tAFANl:t2Mc7LjE9aHD[]A\A]A^A_IAE9~IcHDDAWAVAUATUSH8H<$HHt$H5( dH%(H$(14H3IE1Ld$ H$ fDEu$ #$!!Hڋ H!%tDHJHDщ@HH)Hu$ @LLH@ADD$AEtdHT$ H=! HtbH=  HtHH<$LDŃAǃ"Ll$LHŪH@LPu,H$(dH3%(TH8[]A\A]A^A_Ðk8ĬLL$H _ HqLH5$ A9HDHPHoP1Rf跷H rfDVfDƄ$RIٹL LH5 1dfD 1L) ^H5b A1L) _H5; Ƅ$RIٹLQ) FSڮf.ATAU1SEA114HHtTHUM6HN8u H[]A\DH1L811H5 =L81ɺ1H5b DSH1H=9H̼8'ż8H¼88ۤH[]ff.fAWAVAUATUSHXdH%(HD$H1HH.AI/H?H= HHPHEHÀۅt; H= HÀۅt H= H1ۄþ1AuJE18 A11u(8 I1軪u8 1藪tJLt$$H=S LHL$HdH3 %(WHX[]A\A]A^A_fD蓫8 IuH5 3H=N 踮H2HHuA}H5 H1芤H5" H= mH2HHEH=3 ծ:H5~2H= -H.2HHE H= 蕮IvH=5 ؓIvH=( 賭ljD$ H= HD$7H=& HD$IHuA1Hx pLHuL責zL肵45 t H= H؃AƒvnMD$H=4L€H=| L€H IL$A]UIt$H== =111 HHXLe0I\$AMl$HH軦HHHZLDHÃ1L# H5r ,Aٹ1L# H5K MLD$HD$迦T$9;T$$;T$(;T$,LL$LD$HL$ t$D8IŃ-HHL $ PH1L PH jH5 P1HH f.苧8L)h1PHL # PH5; 1_AXAIt$H= €H  IL$D111HH#L`0I<$M聝HfHt$0qyHD$0ADD9l$$t+D9l$(t$D9l$,tLD$L$ HDt$cHD$0AA9|F1Hvt*轌H赝tH58H7 fDH>H ID$H= L€NH= L€/A8-11L*! H5_ f.1H膽6ɋIuH lfDA}臢HL PH L? PHKgH5 P1臭H fDH= ,H= 舤HHH= KLH=[ 蔝Ń(H=R ݦ`8蹡L 2 LRH5! PH PHvfP1辬H BD1LDS6A>OH5# H1L 1H5 K衣8L s LVH5] PH^ PHeP1H L8襠L LiQH5  PH PHceP1諫H fAWAVAUAATUSHHdH%(H$1Ld$`Hl$pLHH=%H[3HV..H6&~HH LLH߉CH/H HڒRHD$\L= DŽ$`{PLM9H,$DM$$M9Mt$Mt1LYtL1ɺMIH5A 11LHHHuL{LHH1ɺUIL H5 1迩M$$]A^M9\H,$H$1H1HT$\HH߹D$:D|$\E:LM9tfDI|$HtEM$$M9u辆H[EuHFH$VL 1ɺIH5 1ըH1ҾH LHIH LALH#@H$dH3 %(Do H[]A\A]A^A_@HHHHԏyH*4 H"L H5~ W2fHsH^&1ҾH觔L`)1ɺIH1HHHH L1HeV H1HH߀H1Ҿ!H+E1HHHHH"u8L(1ɺCH5| 1NfEA @HH=! LW 1ɺH5 fLH5 1輥AL 1H5 茥gHrL, H5u AH#LDH5E AH}H#fƄ$)$)$J1ҾHKH$H;"&H$Hfo$fo$HHD$)$)$I HCH{@BHHL$HLfoXfoih(),$tH$HH$P11IHHLHIHLHv HuH{HtLpH<$H@L%1ɺ1H5 臣fLa 1H5 \L 1ɺ1H5b 6HT^HI9H$H- L,$HD$L{0Ls(ILc CMLDMLDMLDfH{IHtVIHLp 11t$H5 AWAVATAUrH0HH9$*f)$)$)$)$DKEHH|$L @1?^!QIBHsHI薸H1ɺ:ATI1L H5 輡AZA[ HLd$pI9u>@M$$I9-1Ҿ!HIt$E1HHH uL#1ɺqH5^ 7vL誷811L H55  L<$H$L2IH;$uDIMLM9t&IH1HRHHuLH$IL(H;$<HL$\Hl$@HHL$H\$HLd$ fDIELML;,$IIHt$OtDL$\EtH\$`IGHL$ L#HD$(H9HHl$0MHL|$8IIIMLI9IHLHuHl$0ML|$8HLH|$@HIUH1PL IٺSH5 1|_AXH|$ H\$HLd$ Hl$@Ll$`L5 M9t4MMM1cH5H MmM9u1L 1ɺlH5 HD$pL8IH9u$f.IMLI9IL`H1HHLPH1LHHuL"pLIAV1LT Pt1M$H5g ;YL^lH|$(b:HxĴLH _IH5 1,L1 1ɺAH5 AÝHHIHeIL8 1H5 肝L YH5 [HL1ɺt1H5Q %dMLn'H5' AM1L& H5 AÜf1ҾH)$)$Ƅ$#H$Hfo$H$HHHD$)$fo$)$!HHH Ht$HH'Hu(HtV>.tQ1HHtBE1E111HHՅt)HăuHu(H= H5L2E11jALfHjH []A\fDLt H5 ސAUIATIUHSHHYDHsEHMHHH@XH"H!L H蘶1HHL|4HSHL L H-u LkH[IDAT1L AUIaU@H5 1S1ڏH H[]A\A]f11HH+HSH-]6H-\6H]6H\6&fDL 4 L 91H57 UH[]A\A]DL1ɺYH5 !H[]A\A]ÐLY1ɺ\H5 HLK1AT2H5 L 貎^_fDLMH?L fDHLKEATL H51 TZY{AWfAVAUATIUSHH8dH%(HD$(1)D$HD$ F%H*HZH~IL/H^Ht&HLNIHtHL軅{H/VH߾/HPHHE>HHPHEڀ}-E1<-+LA}=HI)2L9;L} HHHHI|$HD|$ HD$HI|$HHD$ H1LWHHkHD$HE1LHCH11PALSj+HLD$,H hD$ RfHU<-HAfDL 1H5 HL$(dH3 %(H8[]A\A]A^A_DL DH31ƍHk/H[IH.HHLIHLH胃HMAVLA @H]AHfDL 1H5 @fDL1 1ɺH5 ɊL H5s 薊@HIٹAVL 1H5= [XZ_L H5 &,@HMAVL @IٹL H5 Ӊԁ@AUIHATUHSHHYHsL HIċHu3HtNHLZtnH[]A\A]fHKI}AHXHHu1Lr 1H5 H[]A\A]DL< 1ɿH5 وH[]A\A]HLK1L H5c 莈XZfAWAVAUI1ATA USHHdH%(H$1HHHHrH߉D$HD$ Hu H=| L' H=Y LD$4HD$0D$x&oD$8jAA]1hH1hh'qH D$4u|$x|$0EIEHUHuHHD$!H|$Hpnt71ҾH-Aƅj1ҾHSPDEDt$T1ҾH6D$X*1ҾH蛀HD$`HeAI1HD$$Ll$rIHHHhE11H1AHPATjHL$0HH LHAH$tHH`EDDH$dH3 %(DHĸ[]A\A]A^A_fD$41ҾH1D$hHAH1jA]hH5 hhh|H0x1Ҿ]HIHD$(Ht1Ҿ]HpD$01ҾHHD$pH&T$hD$4H|$(AyHD$hdHL$x}L 1qH5 ̃vf.E1c|$x"LN 1jH5[ 聃+L 1vH5. TL1ɺ1H5  A-1ҾH~H|$pD$|D$xL$hBL^ 1[H5 ɂp@1ҾH}PE|$XL 1H5J p1ҾHY}L 1H5 ,Li1ɺK1H5 f.1ҾH|1ҾH߉D$x.~D$|DK1L 5H5t @11Ƀ蔁D$41HHD$H#L H5# NfL1ɺ}H5 !@Lɺ 1H5 AfL)1ɺ H5 h@L 1H5n 蔀;L 1PH5> d L 1H5 4:xf.AWAVAUATUHSHHXdH%(HD$H1huH2;E1E11HHL$ HҔH8H HD$HL% g8{`臗HHH@ILsHIHCPHAU1LC AW6H5J AV@11SUATLL$8!H0HT$HdH3%(HX[]A\A]A^A_DD$ *H7t,Ht$HKH HT$|$H HD$HL%| y7HT"LDvfATIUSHfu2HH'LPHE1E1j1jH []A\@1L/ 1ɺ>H5 }[]A\DH(dH%(HD$1 HD$H$u HD$HHvHD$dH3%(uH(uAWIAVAUIATIUSLHAA@I@(HMLLPH2H8ytPLLLĴIH`HC(H@Ht E1LLL$LLLЉŅAH[]A\A]A^A_D[H*LC(HLLLAPŅuL1ɺM1H5 w|DL1ɺV1H5 O|tf.LLLLPŅLLp1ɺf1H5 |+1L jH5l {LL$LLHC(LLPLA 11_H5" {DL 1IH5 d{ff.@AWE11AVI1AUATIUHSH H6dH%(HD$1D$ jLL${j_AXHHuHHIH|H}M~ HHrHEI _H1ɿLP1L H5 zXZH2 H1ɺLDbHt}HL$dH3 %(H[]A\A]A^A_I@t M}XBL软=IF(HULLL1PYHx2H8svHw EL'gH(fL1ɺH5 qy @M~ HEI ILY 1ɺH5 1*yDLi1ɺH5 y]@HLM1D$ H5Z L P1xY^~fDLML= 1ɺ_pff.AUATUHSHHIH*H;H{H{H{ H’IHHsHZIEHtQHsHEIEHtHE HtIFXt/IL$LL$ILLLtD$uE@HH;$ufH<$gIH蛍fDL9 15H5\ rfL ZH5) raj@AUATUSHdH%(HD$1$D$FYHI1HDMLD$IHEētp<$tjHnDELÉEi/M1PLG 1H5t uqXZ<$u71'1L %H5, q1Ht$dH34%(uWH[]A\A]ӌHmIAT1H5 UML @Ǻ,11:qY^T>iff.AWIAVAUATIUHSH8ZdH%(HD$(1D$D$ D$$uXQH1ɺLXRHsHu1MH LD$EWELt$ Hu1LMH`TAŅ)HHu1jDD$0LLL$4_AXAYHH&HuHIHH}IW HtHHT$hHT$Ht IUXL耥HMLLL$MHLAŅcHGL\OHfL1ɺH5 Ao@IW LmH L1L MH5 @H11AUAnZYHxH1ɺLVHqHu1MH LL1ɺH5 fn1ҾLQ#LiA?1Ou>L>fLi1ɺH5 n@LA1ɺ1H5g E1mLM1L H57 mH\$(dH3%(DCH8[]A\A]A^A_fDD\$EDA1MLX H5 A@11+mGfDLM1L H5 lGD$$H]4k1IٺLh H5G A@11lfDLm'1L MH5 A@11glHLYH軅kfDLy1ɺ1H5 l+f.LI1ɺ1H5o kPf.L1ɺH5< kHIE1PH5 1LO }k^_L1ɺH5 Wk]cff.fAWAAVMAUIATIULSHHdH%(H$1,S1ҾH߉D$XD|$\e1ҾHAI*H߉d1ALt$h‰D$PT$TLl$pLd$xLd$PLMl$0LD$d1HMt&L[]HQHPLLM\踷0Hd$p t$\E11H߾ H!HLHHA1zD$\HH߅t EޮH$dH3 %(DH[]A\A]A^A_fT$XAH= L ? LEH1ɺPL H5 1HiD$`A^A_1HgE1D$dADl$XD$(EtD$PH LHHtkD\$\EMLl$(;fDDT$(E2DL$XEuLHH:t&|$P1LLH ufADLI 1H5 ,hLu1ɺ1H5 AhBLY 1H5l gf.1H膪HD$HLl$0fLd$0ImD$8HHD$H1H E1E11LhHQ1Pj=H HImHHD$HD$,HD$vfDLt$8HD$0M&MI9u&_|$XHD$0I$MMI9t>II~HT$H茸t DD$,EtLMMHD$0I$I9u‹81ImHmHt$Ht H{2Ht$HA蟫f.ADL1ɺhH5 A;f\fDIvHHHD$0L$P1H躨HHL`L5L% f.|$PD$`H11AVAE11UHjjH LHST$`uA1ҾH$D$PTL 1pH5 A&eGL̞ 9H5 d]DVAWAVAUIATUHSHHHLqdH%(H$1f1ҾH)D$I)D$ D$0~[1ҾCH߉D$ k[H߉D$LHAzLAFAMtxH8EHoH$L$taHDD$ HE ML= 11lH5 cH$HtEt1HKHK$CHiKMtLDkt$HH+KE111MLJ< H5 bMtH1HH:MtQo]oeLl$I|$0)\$)d$ jULYID$0H4H4H׸1ML; H5% @11ɃbAH$dH3%(HĘ[]A\A]A^A_EtIEH@@XqHILMB1L H5 aH5QHOL1ɺyH5G Ja,HcI3 $-諷1ML( H5 @11Ƀ`HE`@X HLH8L AWZ1fLpI}1Ҿ4$XHHCLD 14H5Q O`Qf.H#H)M1PLH5 `M1L QH5 _11AHHQL1ɺH5 _HkGWHkH= H1誩< IIuHAHt$ LLL$L$EL$LL$AL;L$t1ۃ|$PHD$@{H8HD$8H|$0H8H$x dH3<%( HĈ []A\A]A^A_ÐHcEBL=HÃ~IZDl$TDLELL$XAAAztUH|$0zH$pEIDHD$f.DH;D$1HHH|$HAHcHT ttHH=uܹDt$pEkHcAIč;D$PALl$0Ll$/IHT5E1\$ D1DL$,HM1fDA HcŃDpL9t&EwIEtA tuA uL9uHc͋\$ DL$,LDqHL$Ht$H H|$IcDDL$ `KDL$ H|$0lBL1ɺ 1H5 [O1DH|$0HHTHTAGH>fD#LEH EDHD$ (D$TAݍC9D$P[D$TtwHT$XHt$HDH|$0J&H|$0AL1ɺ 2L1ɺ UH|$0TTTH|$0fTrDeFDAUATUHHSHHu[HtFH1HMċ;IGH9u,;LLO?HxI9H[]A\A]fH1[]A\A]HHL[]A\A]+ff.AWIAVAUATUSH(H|$xHL$HLD$`LL$PdH%(H$1HH5 HH HHD$XHHD$`fE1HDŽ$)$H-)$H D$lHD$H$H$H$D$hDŽ$DŽ$HD$p@HD$HLI9EIcH;D$~L$1fL)$HH$)$HD$ HDŽ$DŽ$DŽ$|$hEl$EEA EAGhZHD$PH<$H$N01HfDADڈD< HHuH<$H$LL$@LD$8DT$0D\$(BD\$(DT$0LD$8LL$@H4$LϹLHc$DT$8D\$0LD$(=H<$D\$0I1DT$8LD$(HfDDшD< ]UHHuH4$H=l :H<$Ht$ HoOO&G*o_N fF$1))^H) $H<$HHHt$p< tt HHH9uH4$DT$8H= LD$0LL$(H<$H$D\$@H5H[>D\$@~AGtLL$(LD$0DT$8t$A9G8WD$h$HT$`ADL9A8wLHt$P<HH9wL)HL$(=v0Ht$P|HHPH9uHD$HL8 1ɺ7H5 D\$ M 1eID\$ HciD$h t$lu`H|$Xt H|$XEH|$X$BulH$dH34%([H([]A\A]A^A_fHcLQ 1ɺ1H5 HzHD$XHL1ɺ1H5 HnL1ɺ1H5 ]H:IٹL H5d 3H1!HD$(QHD$0L)HD$(H|HiD\$@HL$L$D$HL$8@D\$@HH$HD$(HL$8D$L$HL$HLHHDT$@L$H$D\$85CHD$(HT$0HHHD$PHCD\$8DT$@H$L$< D$(u| u1| D$($H$fo$fo$H$)$)$H޿ϦD\$0LL$@DT$8tLt$HH1t$($LW H5 RLL$XIAQMP1UgFH0HHߋ$DT$8H$HDŽ$DED$ZD\$0D\$ M1ɺWL H5" ED\$ D$(0H|$xD\$ .D\$ t'H5$ HD\$(:D\$(HHD$ H|$Xt2$Dp|Ht$XHD\$ ;D$D\$ HD\$ J8HD\$ yHH ADEDEZH$D\$ !Ht$ H$H$H3VH3H u/H$H$H3VH3FH uHF H9$D$lML 11YD\$ H5 DD\$ 1D\$ HI1AV1ɺL H5 QDZYD\$ HLHLL$@HL$8DT$0D\$(?LL$@HL$8DT$0D\$(HL$XH=w D\$ >D\$ ZHL$(H-HD$0HL5/`1LHHt$ B0 tt HH=u޾ LD\$( :D\$(Ht11MbLID\$(H5v JCH|$ H5 8D\$(HH1LHB0 tt HH=u LD\$ 9D\$ HtML)8 11iD\$ H5 BD\$ HD$0HL$(:@SHHdH%(HD$1HH$hu4H$H HH%H)Hv?HL$dH3 %(uTH[ÐLy1ɺL1H5@ BD1LO1ɺRH5 A19ff.SHHdH%(HD$1HH$u4H$H HH%H)Hv?HL$dH3 %(uTH[ÐL1ɺ71H5 OAD1L1ɺ=H5X 'A1.9ff.AWILAVIAUAATIԺULSLH(LL$Hl$HdH%(H$1 LL$HHufoHD$IGϦD$HD$@AGLL$0D$$H\$(HD$8D$HD$LHD$PHD$XHD$`HnH1ɺ D$AGLL/ AUH55 P1Aw?H11AU IH5 L( ?XZL'L'u&LSVH= H11nIOIWHLNHHL3¸uNL  1H5U $?1&1L 1ɺ H50 >H$dH3%(u]H([]A\A]A^A_DH1H5 ES L >Y1^L<  S6DLVM9wbfH1IL HH5o HR AQM1>1Hf.AWAVAUATUHSHH6H<Iƹ 1HHLkE1L% fDIcDLLH1H7AI9uAoAoNLAoV Ao^0Aof@AonP)EAov`Ao~p)M)U AoAo)]0AoAo)e@Ao)mPAo)u`Ao)}pAo))))))))/HH[]A\A]A^A_L q 1ɺl1Lr H5 I3T$ H LVM2 x[H3$dH $H|$D$$tt0HL A1j1H5Q ";_AXL;$xt/H1H5/ AAUL 1:Y^H$H9$H11ɺ$AL H5 :XZ|$HD$$D$H1ADHIM(It$(HD$XHD$`HD$PPHD$hPHD$hPL$HIM@AD$PIt$@DAjjjL$H Lt$PMX|$EH$2HHHt$(H|$ ILH$:jHT$Ht$8ILL$H|$0HD,1H$`H= HA1PL 1H51 9AYAZD$fHAL* 1PH5 18A[[,f.$-1H|$LUH$D1HHHt$(H|$ ILH$H|$H5o 2IHH$LHH2Ht?Hi1$LL$ L H5 7A]A^$H*Lb4L0,$؃DD$HD$LD$HD$XHxH$(IHbH$KT5HT$LH9$D$Ht$(MH|$ E)LLT$0LT$0H$IHt$(OH|$ HT$8D$0+$F,0L|DL$0HALQ 1AUt$Ht$AVjH5 6H0Lo)1H$hdH3%(cHx[]A\A]A^A_D|$MW1fDHAL* 1AUH5! 15A1ɺ$pLſ H5 $15XZI|$Ht$`HA1PL 1H5 5A1ɺ$L H5 $1X5Y$AL 1ɺ1H5] ,5^$ALp 11H5, 5_AXGM1ɺ L H5 41QL 1ɺX1H5н 41"HML 1$\H5 c4HK'ZY@L,$HT$MHt$(H|$ LkEH$DLϦE1M4AbD$ 9D$t3jL] 1ɺULL$H5 1A3AYAZ11D |$HHLLH螻HUH L2MtLH$*H$IHzHtHT$LH5+ HELL(&H &1EHMLz 1$[L91ɺW1H5 2f.L 1ɺr1H5л 2f.Lٴ1ɺp1H5 o2f.LL$1L bH5h 72H%1L 1ɺ1H50 A1EkD$LH1ɺL H5 PH" PD$8PLL$(11H D$1H|$H|$H5ĺ ',IHILH'L.Lh*L1ɺ1H5` /1f.HALB 1ARt$t$AVj\H1ɿt$LL$L AH5 0_HAXE%1L1H5 0L Lͧ11H5 V0D$LMLH1ɺPH5P LJ AVD$8PLL$(10H t$[f.4$AL 1jH5 1/A[[GHAL 1t$1AVH5 j/H Ls"HFEtmD$L1L5 L1ɺ1H5h 7/LL$La 1H5:  /E1'AT1 AUHHSHH1"EL$1Ҿ?HLDH8LBDG@DΈ HJI9uH[]A\@AWAVAUA͹ATMUHHHSHH HxH$LL$8HD$H$HD$H$HD$H$HD$0dH%(H$h1H$`HT$ IH$ E1AHLABELONEH9$`.H;$hH$ϦHp[;$pL$t HLVM2 001H9$xMt EtA$ESH$H|$@Hp ѪD$,U\$,H$HD$ HXH H$1L% LpHIHD}I>DEtHAM1SMH5 1,YA6ALg 1ɺO1H5Ƶ ,^AvLd A11QH5 l,_AXd@EHMfHH+D$ H$I9t$ALq 11iH5H ,E1I~9Lt$8tfHL$IHIHHt:H=t2HH5 A1PL} 1+^_IHAI<$Eu)I$ID$EwH|$HL$HHDHAL 1SnH5j 17+AXA4$AL 1ɺp1H5>  +AYAt$AL 1ɺr1H5 *AZA[PfHD$0Mt$D8EH4$HH+D$ HDI9t!L 1ɺ1H5 *HI|$Il$AL5 HAHH}EtHEM1SH5J 1*_uELy 1ɺ1H5 )AXuEL 1ɺ1H5 )AYAZeDEH$hdH34%(D$,Hx[]A\A]A^A_fL 1ɺ1H5 \)A11L H5] ))$t fAL 11H5 ($@L1 1ɺH5 (@HELz 1SH5± 1(XuEL 1ɺ1H5 g(Zu1E1H5r L ?(Y^HAL* 1SH5: 1(A[A4$AL 1ɺ1H5 'A_At$A1ɺ1L H5ް 'HkHH+D$0HD$ZYI9t!L 1ɺ1H5 y'I11L߲ H5 U'EL$11LU H5[ /'EL$11L H55 '@HD$ L 1ɺ5H5 LH 1&H$Ht$`H Hx 1L 6IH5ǯ 1&L 11L$7H5 k&fDHELZ 1S[H5j 17&A\A6EL 1ɺ]1H5? &XAv_1ELؽ 1H5 %XZfDL 1ɺ1L H5׮ %JfDL 1ɺ1L H5 E1u%LL$ Lʯ 11H\$`H5i =%L<$HH L21L IH51 1$11L L$hH5 $11L D$pH5ح $Lz 11D$tH5 $IHH a {Lb 1ɺIH5z 1G$TfLL$ L 1ɺH5M $D$,`H$E1LpHff.AWIAVE1AUMATIUHSHHXDL$ dH%(HD$H1D$$HD$(HD$0HD$8HD$@ DU\EHD$$DT$1E1PLLLHD$HPHD$HPHD$HPLL$HH L$$E1ۅDT$AÅAAt5E(HL$HdH3 %(HX[]A\A]A^A_@HD$8HLz 1ɺH5ǫ "fD1ҾHIH1낐`H HD$$LE11PLLHD$HPHD$HPHD$HPLL$HH T$$E1ۅAD\$jHD$$Pt$@t$@AU1MHATD$HߋL$<]H0D\$1L H5٪ !1D\$jHT$(Rt$PP@1L1 1ɺH5 g!nD`HFAIfAWAVAUATUSH8dH%(HD$(1H:HD$HD$HD$HD$ $D$uHD$Dv\MIPHHI11LHD$(PHD$(PHD$(PLL$(LD$ \$ H T\$Eh<LZ 1< H5v E L޺ 1= H5R ! HT$(dH3%(!H8[]A\A]A^A_AtAtLAJLD$MZLL$LLL2Åtf.LD$1MpLL$ LLL FfDLѹ 1ۺ( H5m <1L 0 H5=  L 11 H5 H}lH}aL 1ɺ7 1H5ڧ LD$MLD$M1DLj 1B H5} LC L۸ H5[ 11&L0 1H H5- I L LL$LLLLÅ8LD$Mf.AWfAVAUIATUHSLHhH|$H$LHL$H dH%(H$X1)$)$Ƅ$HD$XHD$`HD$hHD$pHD$xHDŽ$D$PD$THL$cH$11HH HD$ HD$PPH$PH$PH$PH|$0L$LD$tH L$TD|$PEu_HD$`H D$pEh<J1H5x 1LӸ 9H|$ D$PEl?HD$pHt LML9 HD$xLM Ht L9 HELL$xD$PHD$pL$PHt$HL EtIU < H H$fMuM}It$ H)$)$Ƅ$)$)$Ƅ$)$ )$0Ƅ$@HDŽ$HD$8蠘D$(f)$)$EtF D$0fDupEfDH`1L 1ɺIH5 1L 1ɺH5 ay@fo$fo$)$ )$0EtD$(D$0LH$L9ADž H|$H$TH$HD$ Hf 衷HD$ DT$0LEHD$ HI9H$ f.LxIIOH3H3OH eIWIOH3WH3OH LAoIH|$ M)$Ao_II )$RH$H|$HT$XHADž- H|$XHt H9HLABELONEI fo$fo$H$PHLVM2 001H$hHD$DŽ$d H$XD$P)$pA)|$0L$L$HDŽ$HDŽ$HDŽ$bHD$`IHT$hHDŽ$H$ HD$pxH$HD$xH$HϦHHHDŽxHDŽID H0It$H@H@E1Lŷ $`A1AVH5 Up^_t$xt$x1H5 1t$xML t$x :H H|$WH|$u HE1-H=> H1@aI3T$ H LVM2 x[H3$TH !H|$ BHt$ HH%H-H)HD$(HHt$0IH!HT$0Ht$(HHxH5A%r0N*>I3V H LVM2 x[I3FH sA~AHD$(I;FZHD$0H %H LIuLt$8LD|$LIH\$@IHf.HL9ooLLo o0o@op)$PooP)$`o`)$po)$o)$o)$o)$o)$o)$o)$)$)$)$)$ )$0)$@UHLt$8H\$@H1Ld$8uLk 1H5i ATL|$8M.LL$L$D$`XZLM9t-@H)M}HIH tMmM9uH|$ EtDL$(EUDD$0EWL H5 1E1poMk   HH=C g HH=1 H=.k H H= H H= H' H=ݓ HQ H=j HH= HM-LHtDL H!%tDHJHDщHL)H IHD$H$THAj[L1ɺ1H5x GfH|$L # IH5B 1LfDH|$HLv PLL$( 1H5 A_XHHD$hHD$pHD$xHDŽ$D$`D$d\ 1ҾHHH>HD$d1PH$PH$PH$PHT$hHt$(H|$8L$L$z$hH  L$AM¨ D$<EkL 1?H5Ά La 1*H5 lL $L̉ H5k :-L~1ɺ H5B slLU1ɿH5 HT$U1ҾiHaHR H=Y H€ H=Y H€Hƹ H==j LD$HL$LHH$RL~1ɺY cDH$HHIL P +fDL $ 1L H5 L$L 1 H5̈́ HE1jnfL}1ɺhH5 1_HT$HD$H@H|$HLƇ P LL$KfDL$L 1 H5 IL)}1ɺ 1H5 +f.HPH$H$L$H$A<$#AHc= I$HIDP t)IT$DP tH5qL Ht@A# A|,u A|, L˛ 1ɺc 1H5 Ht$xLT H5 LH)oXHH$o`$@&$A$f$$H$Ϧw'H$$H$H$H$H$HHIٺ PL 1H51 XZGfL$L@ 1 H5 !L{1ɺ DHD$hE1D$hHD$pHD$xHDŽ$HDŽ$PH$PH$PH$PHT$hHt$(H|$8L$H DD$hEZ j1@LE1E11HHD$hP$$t$ht$0YH0; H$Ht|jE1E11LHHT$lR$Pt$ht$0 H0D$`t8T$dt09t,L 1ɺ1H5z ISL 1H5N @HD$dH|$11HD$pHD$xIHDŽ$I HDŽ$D$hPH$PH$PH$PHt$(L$L$H |$huCH|$- 1H5 IL 1YH< H$H|$LH臡 HuϦHLABELONEH$HLVM2 001H$HD$DŽ$ H$#1H5~ A$1L HX Hsu#H|$% H= H1? H~:[T$<LHD$pLl$1D$(H$HD$\L$HD$HD$hHD$ L|$IL LL IH5| 1D$(H9l$<@HD$HHL$L[2IHHD$p11LHD$xLHDŽ$HDŽ$D$TD$XD$\D$`D$dD$ht$ AVH$PH$PLL$ LD$(tH T$\E1HD$pAH6H$HjLt H1ɺAUI1L H5{ AZA[D|$`E3|$dE1ҾHIHLt1ɺ 1H5c{ 2U H= L€LH$H$HHDŽ$HDŽ$ L H$L$HLs1ɺ 1H5z H1H5z 1$L$L \Y^HLz 11$L$H5Mz !AXAYfo$$Tfo$$$,LYHMPH5y z 1LO} Y^LV~ 1C H5y D$PE1E1HT$dE1E11RHHT$`R1$PjAWHt$H賳H0D$\AP1E1,L$D$<M!E2M ALL$hHD$pM9MHL< 1ɺP1H5x XZHML 1ATH5x 1eL(A[IXMHt$HH|$MLLQHMMLLH߽MLNH|$LD $D $IAOLL$xH$M9&MHL 1ɺPHT$`E1E11RHHT$\R1$PjAWHt$HH0D$\Ad@ H={ L$Lv [ H5Dw L 1\ H5%w @H$L,p11 H5v .Lhy 1ɺ{1H5v H$H8@I 1Lz H5v Qt1H5jv 1L n +HH= Z7#3L 1 H5t LL m1ɺ1H5s Ll1ɺqL g H5s itI 1Lw H5ns =/Ls 1ɺ1H5Hs $LD$LHH$HL$HKLD$HL$HLHL l1ɺf H5r EA=A1L w H5r [~EAArL$MfH|$LD $臦MD $IuH|$L.AIƋ$P $LL 1ɺU1H5q D $D $EMM-E1H=Ov 2-D$8 AFL$1H= D$<'HD$H: HD$HHX`HD$Hx@IH7 H+H$D$,LHHD$L9 Lt$HDt$D$HiH|$@Lp IH5ut 1+Lr H5Gt L@q H5 t Iٹ1L$t H5s Lq 1H5s ]ID$HLL$@Ls H5s LL$@Ls H5fs H|$-LTI\MH5&s H APLp P11ɃAYAZD$,D$H1LEH5r kLE11H5r Ju1Lo H5r #)}ff.@AWEAVAUATUHSHHHIHMIHH LD$8LD$HIWH{LLD$LD$HI$H{LID$HH{LID$HH{HtID$HLntH[]A\A]A^A_@HIDHLG< [H 5] A\A]A^A_VL9p 1 H5q )LHp 1H5p ifDLq 1H5p TH{LfDL 1H5p kAVfAUIATAUSHH`dH%(HD$X1)D$)D$ )D$0)D$@HD$PH$H5 HARwH HtMHE H@XHt@11HЅu3LDo ?1H5o OD1t 1EH{HWL p HHtH{IuHD$0HD$HH{IuH$HHHt$1ĴHD$HtAIHDd$$Ll$(訧t'H׬H{HHD$H H{D$HD$ E1HIHHD$H1E1ID$E1HHuPATHXLZHL$PtDL$HEtfH5- H趬HɦLD$@HL$8H,f.EcH蚦LD$@HL$81H4$AHOHL$XdH3 %(1H`[]A\A]A^fD1HIHHD$HE11ID$HAHPATG^L_HDD$PEH|$L1L@1ɺH5m 蜽D$LDL?1ɺ.1H5l of.Lll HH5l >LWm tH5l L9l Qf.Lz]H5,l 込e@LJbH5k 莼5@1L>1ɺH5k _D1L>1ɺH5k /DL DUHSHHH:u9XLrRH[H9lH[]@H@L l "H5m LHH1茻H1[]A1(Ll H5Qm YH1[]LMHLk H5"m *1`SH׻t [fDLG=11ɺRH5l ݺ[fAVAUIATIHUHSH0dH%(HD$(1Lt$D$ LL裢H1ɺHh LQLLL$ZY"L HLQH HÅLuHL#ÅhLk 1ɺm1H5k 迹H!Åm1ɿ1tL k H5k 茹LLDl&DL;1ɺb1H57k ?HT$(dH3%(H0[]A\A]A^@La;1ɺB1H5j Li 1]H5j Ӹ뒐H8:H8MD$ @LYj 11ۺwH5zj 肸>DHL|i iIH5Cj 1I@Li 1oH5j "fAUATUSHHdH%(H$81 IHIՉL14H߀$0謟H߉D$蛟H5H߉l$D$L,$蠥u*|$Li 1ɺ)H5i bH:HbB|$1HIHHHLKbLH߃%H$8dH3 %(HH[]A\A]fDLh H5,i 豶L81ɺ+1H5i 肶xD-@L 18H5h ?5f.Ly81ɺ1H5h  fAUATUSHHYHC HHII9uDHH LLAHVCH[]A\A]H5HuL71ɺ.H5xh V1Lg "H5Kh $H[]A\A]@LY71ɺ2H5h H[]A\A]ÐAVAUATUSHH dH%(HD$1AIվW1裯1ҾWHKHHD$H$61H,HHHE11DHEALHH>PU'>Dt$Dd$AXZ E)1EH5/g ^@H11ATLf Y^HHDHL$dH3 %(H []A\A]A^LYf 1@H5f A莳@LZ 11FH5f A\iL 1TH5Sf A&3,f.fAWAVAUATIUHSHHHYdH%(HD$81 tH5nLtH6MCH6aH5HAn5LLkHL4LI茚DkE7H{(S 1IL\tNL|$(HLC.Cs MMH{(H%e H1Ls(A2H5H3LHGIHE`H-U HtHh8[(1EcH Ld @HH5d 1ATUP1SAV\H0HL$8dH3 %(HH[]A\A]A^A_ÃH%3HCH3HCHSHsL}sCI|$F4Cs sHHC(H{Dkf.3H3HD$3HA3t$LD)HHI3HD$X3t$LL%2T HHHE`HtL`8HHT$24[HAWHT$1ELRi R@Ǻo1ATH5"c 1USAVH0fD 3H3HA2D)LHEHI2H2LH HI3H AW1EATL{h hS@H5b 1AV1LH 1M=LgH5Ib @11@LQ11ɺQH5b @Lb 1WH5a 輮_¦fUSHH $HHDdH%(H$1HH$H$IHH a HILa 11H5Ua #HH޿cItD1La 1ɺH5a 1H$dH34%(uiHĨ[]@L_a 1ɺH5` 詭fH11UL a Lf H5` sX1ZxATUSHH $HH a HBdH%(H$1HIHIH߾Bx~11ɺH5!` IL` 1H߾覡ǽBu~H$dH3 %(H[]A\fL賔tH1UL 4` 1LH5_ MAYAZ蛣8 I1PH L"dPH56_ 1XZB[ULe 1AH_ H5^ P1ɫ_AXH1IًH5^ 1L_ P1莫Y^蒣fAWAVAUIATI1UHSH(HL$H\$@HdH%(H$1HHAƉǺHZDI菚EBMc1LLH5&HBD<ޞtYIL^ 1ɺ1H5] 赪1H$dH3%(JH([]A\A]A^A_f.H߾ HHxHPH=^ H HΠHtH|$Hs3Vf[8贞I1PHw LaPH5\ 1ǩXZEIL] 1ɺfDIL] 1ɺf.1IL] 1ɺH5\ \]ff.fAUATIUHHSHHLiMtH[]A\A]H(uHgu1ɺMH5[ L%] ƨHH膙uHՐt9LL ] 1H5[ vAET@H輚HLb SA1H5b[ 0XZff.AVfAUATLUSH0HdH%(HD$(1)$)D$D$ I9tMIIHHAEL9t-HCHo)MoP)UuHAL9uHD$(dH3%(u H0[]A\A]A^t@AWAVAUATUSHH $HHH [ H<LdH%(H$81Lt$0HIL6L1躛AŅML[ 11H5Y I账I$L9HL= HI9tqHC !Ho)EoH)Mf|$ DHy距81MPH5fY LC^1AW)HY^I9uD蒕u~H$8dH3 %(0HH[]A\A]A^A_HtH1A$L BZ LH5X 蘥[1]f8D M1PH Lr]PH5X 1WXZBI$裗L^ AHY SPH5BX 11AZA[[HM1ɋLY 1H5X P1ΤAXAYМAWAVAUATUSHH $HdH%(H$1I諗HHHL-:E1L=:H谠HHz.tLHHHHMMRH1hH_AXtd8t踘lI1PL[H5W 1AWѣYH^HHgH谝u,H$dH3%(uVH[]A\A]A^A_ۚ84oM1PH:Lb[PH5vV 1GXZNff.AWAVAUATUSHH $H@Hn8H|$H$IL$H$HHt8dH%(H$1D$(D$,HHH &V LHD$I1ɏHI@H IHDW H%A DD$A1聏ADžH $Ht'HcHW 1H)HQAL辸HM1PD$(LV H5U P1AUޡH 1L薖ŅEufA)EIcHމyLD(H01ɿL\ AUI1AVH5T XAYAZ͐uH$dH3 %(H[]A\A]A^A_k8HH|$ L获L}[ SIAV1H5S 贠X1ZkH|$Ɉt%Ht$L S L˒t$LY AHS H5hS P18A[1[fDH\$01HHT$,Ht$(HHLD9l$(5H|$T$,LDt$(T$zH"T$Lg[ AH5R RAVD$(P1AUt$0U舟H0|$0H4$HH脗H|$}LSIt$L[ X葎d8轓M1ɺPH LVP1H5Q О_AXH|$LQLpX ID$PAUH|$衆LH1ɺt$ID$(LX H5eQ P1AU.H DL+ƴHnHLX UAAVS1H5Q ߝH 1@;艒M1ɺPHL LUPf.KHHLW AD$ PAUS|fDH軏4$1ɺAD$ LW H5_P P1AUU,H Dt$,l$(L迳HLwX AVIUD$0H5 P P1AUt$8֜H0ID1D$9D$,H1H5O ED$ LW P1膜Y^:*HҎHLzX SAt$U]Zf.AWAVAUATUSHH $HfLH|$LdH%(H$1)D$@)D$PD$`M9HD$pIHl$@HD$HD$ 葋A_XI|$Ht$`迨I|$Ht$@H-^D$<u!L 1ɺH5o> BfLL$`D$ D$MDt$0ETD\$HL? 1ɺ<IH5f= 12IGL1PhHD$(|$81HLL羃 rH߅ 萠H8|HLJ SAH5< 1謉[A^HьD$HIULL;,$uO@H$dH3%(D$HHĨ[]A\A]A^A_Dt$4EIULL;,$tIDHt$hH#6 A$ HD$hIvHHHH=1ҹHLBL羃pH߅TOLd> 1ɺ\IH5; 1{FfI9uIvHdfDkHANjT$ tH=17[H[fD{zLG +AH5(; 1D$HL羃pH߅sHzH1ɺ$SAL= H5: 1蒇AZA[HD$(7L羃oH߅tlL< 1ɺIH5w: 1CfDL< 1ɺ$IH5C: 1|f.諝HSyH1ɺSAL=F H59 1ʆ[]yLZ 1ɺ1H59 蟆DL$EAHu~EtyLn4LeI 1ɺ1H59 SE1LknHT$`H5< 1vwfDHA  Lt$pL4HLLHHLt$0lL$<H\$pL9af.H{L< 1ɺIH58 1sHL9ufDL羃mH߅L ; 1ɺbIH5S8 1f.HHHT$`LL$`ML^; 1ɺ1H57 Ą L羃lH߅(KL: 1ɺIH57 1w?fL羃lH߅8La: 1ɺrIH5c7 1/f.HȚHpvH1ɺ<UALC H57 1AXAYfDD|$<D$4H<$}H-7D$<R@L羃kLH߅$H1ɺEAVI1H56 L8 JY^uL\F 1ɺAH5K6 1fLD 1ɺ1H5!6 HL$\HT$XHI|$LD$`D$<D$\fDcH uH1ɺbSALB 1H55 肂XZH#HtH1ɺASL8 HLfD$\HHT$`BLHjD|$\Lt$`H讘1ɺH55 AWI1AVLD ցY^D$<HkM$LHILB 1ɺkAWI1AVH54 qA_LXiH߅LF7 1ɺlIH5a4 1-˗HssH1ɺrASLA cLt$`H蓗H1AVI1LjC H53 蹀XZ$f[HsAVLz@ 1ASEf.LL$`L)7 11H53 ZDHrH1ɺ\ASL]@ ˖LA IH5(3 1FL羃hH߅肖I*rH1AVA1LA H52 _AXD$ D$T$\HL|$`T$ +IqH1ɿT$(A1LA H5y2 RAWAVBH D$<L羃SgH߅ÕL4 1ɺMIH5#2 1~f.L羃gH߅sL5 1ɺIH51 1~f.LfyHT$`H535 1ofDH\$pL9f.H{跘L=1ɺIH5G1 1~HL9ufDHH\$pL9u>@SL4 1ɺ'IH50 1}HL9ZH{G[tL4 1ɺ)IH50 1p}fDHoH1ɺMASLM= HoH1SAL@ H590 1 }_AX2LL$`L3 11H50 |8L11ɺLH> H5/ |LLHD$\\LdL1ɺ1L2 H5/ X|L2 1ɺIH5^/ 1*|LHdt&L+3 1ɺ#1H5%/ {InLr? 1ɺ#AH5. 1{kHnH1ɺlASLU< LmH1ɺAVA1L#= H5. b{D$lAYAZ`sAAWfAVAUIATAUSHHXdH%(HD$H1)D$)D$ )D$0(ctHcHcbHbL 1 L> H 2 H5- LD11z1H>HHHD$1LDHEE1E1HHAPU:AXZL$Ht$ H輖T$Ht$HH+t$ HD$T$蝖Ht$HDl$ID+l$胖DL$ID $r1L> H5, @H1HL$QT$1RAVAUAWDL$0yH0HH貾HL$HdH3 %(DHX[]A\A]A^A_@HafD1LJ= H5T, @11yzL< 1H5, AxOL 1H5+ Axpff.USHH $HH P, H dH%(H$1HHIHe1ɿ1IL/ %H5T+ 'xHiu+H$dH3%(H[]f.Ko8tl(I1PH L/PH5* 1wXZfDH!1UH5* L V+ LxwY^V|off.AWAVAUATUSHH $HH $H11ɺ;L. t$AAdH%(H$ 1D$ D$$VH5* vXH=V* ZiHDIHl$ Lt$H$@LsHHz.tE1HHLHHRHߺL ) L pLHHLHHD$(D$,A[A_Ht$D9l$gD$ 9D$Y1ɿ1IL- NH5) uHgtBn11D$T$HH5& jt\L) 11H5$ \q@H=% kH=% m11D$MT$l$mHl$`D$PH@H=o$ 4H=$ (H=s% HHJ1ɿ1Lu6 UH5# pHdLu6 1ɺc1H5# ipHhL1ɺjIHu0*DH{HLpHHbLH׮IHuLwHD$PMHHHHD$<$AYLn1HlIHL|$@HD$0IFM/M9H,$8MOLD( 11,H5" [oIEMM9IIwHH߅WWuMzaH,1AWA1LI7 H5"" nXZ@H WFHVDD$6HVA BHD$PHl$`D$4HHD$HH蜴D$8D$ A mfDHH5$ XfHt8LA H=n7tLw AL 1ɺH1H5 gHA@JYL- AH5 1\gALa- 1ɺDLd$Hl$ Ls@Lk@M9Hl$L|$InT$8H[]T$HLk>1ɺ1H5 Y_SDL1ɺH5V )_T$yQT$L$ AH H5  RP1^XZIT$3QT$L[$ AH/ RH5 P1^_AXT$PT$L$ AH` H5 RP1X^A[X(PL# AH UPH5H 1^AXAYLY1ɺH5 ]H߾FIz~tL% 1ɺIH5 1]UH8HuVHEKL, 1H5 AQ]:1ɺ<H5X 1L ]Hd7HHD$PH$;H4$HHLH4$1ɺHDH1HHH4$HHHE1H€HjLL$Ht$KHD$Y^H2H|$aH|$naH|$ HD$HLL9t3Ld$IHHCHHx@HL9uLLd$L $L( 11H5 A[Ht$HlLH<$KH4$1ɺH`CH|$^urIMH1ɺAAWL" u HtLHH  H[]A\]@[]A\ff.ATIUHSH5>u HItLHH H[]A\l]@[]A\ff.ATIUHSH=u HtLHH H[]A\ ]@[]A\ff.ATIUHSHu=u HtLHH X H[]A\\@[]A\ff.H1USHH>tVDH5HiE¸t!H5HOEu+EH[]fD@fH5R HEtMH5HDtRH5p HDtWH5_ HDudu'@EH[]fDE[u˸D91IL "H5 SAWAVAULo@ATUSH(H_@T$ HL$LD$I9EAE1E1$Af.HL9HkHC=t߾H2=t&1ҾHIDHAă1ҾHHAu AyL$ D thA~ ApHL$IH_IcHHHPLL9LHT$HtL:H([]A\A]A^A_E11L1ɺH5 /RH(1[]A\A]A^A_E1f1(S10AЃEЉЃ@EAAff.ATIUHSHdH%(HD$1FHtluWHt$~ÅI$L$9tGHL$dH3 %(H[]A\@tҋFuI$HxhL IH5 1pMEL1ɺ1H5 ?M_EEDAUIMATMUSHιHdH%(H$1Hl$HHHC@[tHEAHHLuHKA[us1MHQP@HIE1LjUjH H|$HHteH$dH3%(HĨ[]A\A]fHtHT$ HHD$ HK[HHrHFXH$HEHE1M@HQP=DMe/L1ɺH5 K'L1ɺH5 tKL1ɺH5 DKJCf.LBLJ1ɺLBLJ1LBLJ11ff.LBLJDAWAAVAιAUIATMUSHHLL$Hl$ HdH%(H$1HF[tHDEHEDHHLC[uw1MHSP@HE1E1HjLUjjH ۃH|$XHtLcH$dH34%(Hĸ[]A\A]A^A_ÐH{HT$HHRtvD$[HH@@\HE1M@HSPH@HD$L 7L1ɺH5 $I4La1ɺH5W H@f.LBLJ1ɺLBLJ1LBLJ11ff.LBLJDAWfIIAVι/MAUL > ATUHSHLj H$0H$H$H$Ld$`H$dH%(H$1HK)D$0HD$81MHH$IEHH$H$H$H$H$H$H$H$H$H$H$#H)D$ H$M)D$)D$@HD$PHD$ `L$L$L$(H$0HHLH$xH$HH$H$HH$H$HH$H$HH$H$HT$H$UHDŽ$8@$H$HJxH$H$H$HH$0H$8HHDŽ$TH\$hMLLLH}!1MLEIM@HMLLPATU?H H$Ht!_H$dH34%(H[]A\A]A^A_fDH}HT$HT$1MLEH@IjH$L3^L1ɺmH5 ETLY1ɺtH5O D$fDt[@HH HH@EAEt H ]Ett H mEuH QEEHRI11jE1H5ZYHfD1L <H5 B1HDHHHH2fEEtH|EAEtHE`tHELHO@f.EAEtH-EtHYEH)@AVAUIATUSHH >dH%(HD$1HT$Ht$t}Ld$Lw4HH@A|,_HDHtaLsL L7AąD+A}t~Ls(AHL$dH3 %(DH []A\A]A^D L^ 1E1H54 @@HFFAHF(@HD$AHC(x@LY 1H5 |@K8fAWIAVI1AUIATUSHdH%(H$1W1ҾLAGD1ҾLAG11ҾLAG 1ҾLIG0 1ҾLAG$1ҾLAG(AG,IGHtPA@<AAF0~5H0>@!HH4@HH9@H9uIoLHÅOA=A =p j==$ 1ҾLLIF8$'1҅ LIF@fA>vfLHDŽ$)D$`)D$p)$&_IE@HD$I]@E1H9\$u6sAA A@HH9\$BHkHQ(tݾH@(t1ҾH-4A>HAăuLC1ɺ1H5< =L"1ɺ1H5 11=uD1ҾL]LIF8%1҅ L5IF@@@_1ҾLLIF8_%1҅% LIF@?1ҾbL1ҾcLIF81ҾdLIF@IFP=1ҾLvLIF8$1҅k LNIF@DAF01ҾLIFHrH= THD$8HA A tIv@H|$8HagL+1ɺ\HD$`H IE@IM@1HL$HD$H90ALl$PL|$HLt$(MD1ۀ#5HL$(AADHD$HHD$H;D$HD$HXHR%tξHA%t*1ҾH.1HHD$(8Aă 1ҾH1H+-.HL$(HA0@1D _A~  WIcH HJHL$HHѐf.1ҨD 8A~ 1ҾHB0IcHH4HrI׀H9\$A61LL@E1VÅ,IW0qL['qLIG0!tAGL!tAGL! ML!tAG LL!tAGAG$Li!tAG(oLK!t8AG,.DE1LI1ɺ1H5B 8H$dH3 %( HĨ[]A\A]A^A_@L1ɺ41H5 8DI8H|$8Hc HD$pHH\$8IHcHH$H|IHcHHD$xHtWI@HncHH$Ht/IHFcHdH$HL1ɺYH5 17H|$8PLι1ɺ-fA@HfHfE1H|$8HbH HD$0Htt/HL$0IcHL`}DIcHt$0H|`֒aHD$0L0L9OIcDd$\HHL$@HAHL$HHDLHD$IFL|$HD$ AI!%tDIWLDHD$@IL+|$Ld`Il$I9H\$ _H|$LHp'uL1;_HH|$LLN'uM1A}_ILH-tHmI9tLmH|$ L-uH腐M6L9t$0Dd$\-DLl$PL|$HLt$(AI}aH`Ht$` IF@HH|$8NIL 1kH5l  5H|$8oNuf.L 11ۺ$H5- 4DALJ1Ҿ Lv1ҾLI0`IHI8Å(ALJP1Ҿ L&1ҾLIIPHIjÅALJ@1Ҿ L1ҾLIIHIÅ0ALJ1Ҿ L1ҾLI8pIHI@ÅALJX1Ҿ L61ҾLI IXHIzÅ`Ly1ɺ1H5r 3+f.1ҾLLIF81҅6LIF@1ҾLLIF81҅LYIF@Iv@H|$8H] L1ɺRHD$hHf.H5 /2H|$8KLIF@:f.LIF@f.LIF@f.LIF@f.LcIF@f.LCIF@f.Ht$pI8HI}H$H\IHtrI}Ht$xH\}IHtQI}H$Hh\YI@Ht-I}H$HD\5IHsDL1ɺDL1ɺ1H5 w0fLAGfDL1ɺ1H5 '0CfLi1ɺfkDHt$hHv[gL@1ɺIF@HL LH5 /$fL1ɺ1H5 /Lñ1ɺ1H5 Y/uL1ɺL1ɺ9'fAWIAVIAUATIUHSH8HQ8EOdH%(HD$(1HFLl$HHq@MG0HD$D$$AG,jqPLPAG(PAG$PAG PAGPiH@HHET$HL$ MI8LD$$LHgE_@EA>D$ D$ ====+1E1L H5G -@H\$(dH3%(DH8[]A\A]A^A_f.IV(I$HBHtD$ 7@=aIW8HDL$$DD$ HL繀Af1ҾLQIvHHt0H(u$LP H5P ,fAW@A>D$ tI$HBHH$HEtYwI|L 1H5 A],t 7IW8DD$ DL$$H;HL{AH)ADL91ɺH5/ +@L1ɺ31H5 A+@HL H5 f+qL1ɺ9H5 A;+yfDEE<H}AiLV1ɺFH5L A*IW8HDL$$DD$ HLAqIW8H#DL$$DD$ HL@AAIWA7HLLcAIW8DD$ DL$$HHLAfLi1ɺ=1H5b A)7@E_EHH6HDHIWA7E1PE11LjU胞H AgE/EHmHHDEN0E+LIWAHPUA71E1L6Y^A@EF0E |$ D$$L-bHkLD辪L*IWAUALA 1ɺC1H5* (fIWHHPA7E1E1U1LjjpH ANfDEHHHEfDEHHHE|fDIWHHY놅L-nHLEIWHHY DAVI։ʹVAUAATUSHHdH%(H$1HHH4$H1T$HLt$hjL1ɺ`H@IHHHUHAD$ DBD$@BD$@BT$@|$HtWHMHHLHŋD$@ttLH0lH$dH3 %(%H[]A\A]A^HHE11Il$E1LDPHATjnH ŋD$@uHHBxL? zH5 l&LHHB1H4; L nH5 &LH1k@LHkLF1ɺjH5A 1%ff.fAVIAUIATIUSHHY;C@Lc8thHHLLSŃ@L1ɺ1H5 G%K@HC8[]A\A]A^fIHB11 uDI$uS@Lc8;HHLLŃtg1L1H5 $K@WIHBw CLȦ1ɺH5 `$HHLL#ŃyfDHHLLŃHPHLLŃHHLLŃ`HXHLLŃ@kIHB11wAWAVIιVAUIATIUHSHH^LD$H|$ Ht$hS LK LD$dH%(H$1HCHL$ ƒ@1T$h$HLeHHQ@HXC@ =L( H5 1E1"HEHLgH$dH3%(D)H[]A\A]A^A_AL11H5 ,"f.K DL$LHDD$LeAnDC t$T$=L UC @=tmL nL٣1ɺ1H5 E1l!Ht$LMILAfD$T$tLHutIHLL&AxH uxHt$HLh(AAIHLL[A$…tLttL-aLUf…tH PptH }]H NQD@I1ɺff.fATIUpSH&LH߃[]A\fATIUSHtH߾pLH߃[]A\lff.RfBfAV1ҾAUE1ATUSHHdH%(H$11ҾHHHkHIDHl$0Hj VH;ILHHD$pMtH=IL}D$p1A@lj|$@DB1@B4IHXELHHDŽ$LHL1j$0D$tPD$xPD$|P$P$PD$L$H$HH$PAXH@HHH$HLHPBH$H;:HXBHoLHBH)o$HPB`BoL$pBoT$ B)H$dH3%(fH[]A\A]A^AL55O LLD$@D$p\1ҾaHAŅMtH=GLuD$p1@Lt H5 fL.vH1,L1ɺH5 !LÅ1L 11ۺH5= DML` 11۹H5 H1AVL FL7 H5 vXZ6L1ɺ1H5 G fL 1H5 L, H5L fL)1ɺ1H5" dDSHdH%(HD$1HPBt}1IHt:HPBH4$btyHL$dH3 %(H[DL|1ɿH5w fL H5L  L4 H5 [f.DHaHfH3bHfSfD11 [f.AWIAVAUL- ATUHH5< SHIWDuLDE1AExIHHË494tU_t@A_tjEHLtkHD[]A\A]A^A_fA_IDDuA_HIkfDuHTfE1EA@DuAH.@E1uAWAVAUIATUSHL6H|$Ht$(dH%(H$1ILt$ D$<HT$L9HD$@HD$0@MeLd$M9#InM1DIwHM?M9uI$D$8HL|$!D$8HIL9t`I~IHIl$HIuIT$H|$HtI|$Ht$0@+LIqHL9u|$8~^MN1L H5H L 1H5$ H|$ cqD$<HL$HT$(HHL$ IH9t9HD$L1ɺH5 19@H$dH3%(D$HD$0HD$PHD$HM/L|$M9tHEHMLHH$LHpH<$l tI $LLM9IHpH|$HkoHl$HEH9l$ M>HD$M/L|$M9uHD$@H@L$<D$<LML 11 H5> L|$( I?%/HHnHuI?H@1HCHMH|$HnHl$HEH9l$ @H$dH3%(H[]A\A]A^A_HuH|$H蒑D$<"M>L|$M/M9H\$Ld$0I@LtsH}L ucHMO1ɺt$8L9 H5 XHZ^nH|$HmHD$(IwH80HE<IELMM9qI]DH63 AWIAVIAUMATIUSHHl$@HD$HEt A@tfMtLL61MLj1H51  7E1H[]A\A]A^A_@tFMtLLML 11H5 ,EtFMtLLML 11H5{ EtFMtLL5MLS 11H50 E1ELLo 1H5 JH1[]A\A]A^A_fM1H5 L 57CH[]A\A]A^A_L 1H5C 7DML H5 1qIHH5 H  H MtIPM1L VH5 QRH f Hs MtIHMPL+1H5O XZ)@7L +MLH H Hf.AWAVAUMATIUHSH(H|$H4$HtHMtIED$A,MD\$HI $AtTEHDEwHtD HtH@HtCH4$H|$ЅuMtDHI EAuD$H([]A\A]A^A_H<$ǏAHv DHc H>H@H@H$H@H@H%|H@@Mn*H<$JH$H@XHD$H$1H$H@XHD$H%H$@^H$H@XHD$H-H$H@XHD$HH$H@XHD$HH$H@XHD$H?H$H@XHD$H1H$@\|H@H@ eH@H@HQH@H@H=H@H@&HH@Hp H@H@HH@H=SHp(H@H=e Hp(HHAxLH<$6H<$ M \$0\$!DAWAVAUMATIUHSH(H|$H4$HtHMtIED$A(MtDHI E\$A#tTEHDEwHtDHtH@HtGH4$H|$ЅtMtDHI $A#uD$H([]A\A]A^A_A"H DHcH>H<$H<$1H<$H<$1uH<$HgH<$4YH<$KH<$n=H<$/H<$!H<$褁H$@[H$@ZH$H@XHD$HH$@[HMz@H$H@XHD$HH$|H$H@XHD$HcH$H@XHD$HJH$H@XHD$H21H$H@XHD$H3H$H@XHD$H H$H@XHD$H6H$H@PH@`H H$H@XHD$H&H$H@XHD$H'H$H@XHD$H.H$H@XHD$H/jH$H@XHD$HQH$H@XHD$H8H$H@XHD$H"H$H@XHD$H!H$H@XHD$HM\$AWAVA@AUIATIU1S1H#tNHtIsEHcLHA)L1HIcLw A9~ Ń#uAE?H[]A\A]A^A_fDHG(H@AWH!IIAVEAUATUSHH(Hi0Li(H<$HHDA>ADDD$HT$H<$ L\$H='AHDT$AAEEH1MULU H5V AAZCA[L\$DT$ fDE1E1tvAEtfHs H;st\H<$DT$L\$"HsH<$HD$"HL$LH= H1PL\$DT$HT$1HLH= DD$KL\$DT$xHLd< 1H5u ~@AWIAVI1AUIATUSHHH/H9IHta8/HufH;/t/H Hu5LI}HH)HHtiMtIHH[]A\A]A^A_ÐML 11H5 LN}1ɺ1H5{ L 1H5U vfUHH=; SHHt]1HH/HHHuH}HH[]fIٹ1LJ H5 9H1[]AWfMAVLAUATIUHSHHhH|$LHt$dH%(HD$X1)D$0)D$ )D$@HT$0Ut]HHT$ L1A׉Ń E1MtID$HtDhHL$XdH3 %( Hh[]A\A]A^A_fHI9tAŽLt$tDLHHt$H|$AAMtID$Ht@DEAt!L`{1ɺY1H5 D9HALH9\$7\StL!{1ɺT1H5N D11LzNH5 NE1AWAVAULATIUSHHH<$I9IE1pLHH<$AAMtID$Ht@DEAt+LFz1ɺu1H5s DL$ DL$ HD9ALL9tK>RtLz1ɺp1H50 H[]A\A]A^A_E1MtID$HtDpHUHSH/HHHt%H1HXHHtXHH[]fDHXHHuIٹ1L* H5p Ly1ɺ1H5> DHtGHFHFHFBPF LF(HHF0U1HSHHHL1Hx Le0Mjf.1ҾH衷:HA:HHrHIuL ]N EhwHE0Lm8ML 1ɺH5y 1A/L H5E 1E1HL$dH3 %(DH[]A\A]A^DHL IH5 1QE1@1ҾH9E(LMLL5}H1ɺKMAUL& 1H5u ZYL@ML RfDrHtoD$EHt$HIHH tGDID$0HE0Jf.ID$0HE0fL-5" @A}HH5 M1AVL' 18^_@La 1H5S fLy 1H5# Lخ3L1 E1亗H5 KfDL 1ɺ:1H5 f.LYr1ɺ11H5 E1>D$t)L 1H5R eL 1H5) <AWAVIAUATAUSHHdH%(HD$1HFX@Ń!H-@HRJzC[0AHbe"IvH=H{P貭DHL,tLp1ɺ'1H5* E1t1Ht'H诨LxHIGX@7c*H{Pqq1Ҿ4L:AŅHCPL H5 L1;fDDHL:HCP@uAcH8oHL$dH3 %(DOH[]A\A]A^A_DHLi 1ɺIH5 1AF@H"nHIC1M,L H5 @11H.b'fHH LxHIGXLLVAŅLL@ HIHL AWI1H5 SXZB@HsHCPHLo IH5 1E1VfHCP1LD$LH;D$H}H7 L> I덐HL 1ɺI#fHHHH5 UIL 1DY^HAUATIUSHHHFX uc@@u LKH1H5n L" 1HHL[]A\A]1fHH IHtGIL 11H5 yHEPLEHHALLHV'HCXCDH[]A\A]DHP HHwHCXff.AUATIUSHHF[t.Ht$H$HhHHEX@H`ŅtR?uH[]A\A]C[tHtH@tHLA1Lk1ɺTH5޹ GH[]A\A]f.HLSUHHIH?1PILg H5u @H11AUXZff.AVAUAATIUHSH|CH]H9tgL5jf.HH9tLBuWH{趣tHsLFuM1ɺtH5ɸ E14HH9uGC[D]A\A]A^Laj1ɺn1H5 E1fUHSHHKt".Huk}HuZKHu!4>tpEH[]DHߺKfEH[]1L H5÷ ,H1[].HC{}H.f1ҾHOQDAWIAVIAUMATIULSHHHFA[H1A]H5? ŅU1A[HA]H5? HYAE]H<I^H߽AH[]A\A]A^A_fHuWHD$@$HELg1ɺ1H5 oD1H߾YL L{ H5ɵ ҃HD$@HR LD11\LYg1ɺ1H5 11Ҿ$HEwL 1ɺIH5< 1fD1ҾHLHAEMŅtbAuHLw 1ɺIH5۴ 1B$D\H[uG1Ҿ]HILYf1ɺ1H5 f.L 11H5Q DAWMAVMAUIATIzUHSHH1ҾzHAEA1ҾHEt1ҾH;HUAEMAAIT$HHHHH HH H HHH HуH ugubttUEI\$(@91Lw IH5# @11ɃEHDeAtFEAKu A9r`t\FuUH[]A\A]A^A_ÐEt81L H5 @11EfDHhLI1H5H H1[]A\A]A^A_þHHID$HtAEAtKuDAEf.1L BH5 1DAEfDh1jL~ H5g ZY1H[]A\A]A^A_f@HCLz>If.1ҾHAEA1ҾHHߍ4uI61ML H5 @11!DeAWIAVMAUMATIUSHHHT$tU1ҾH HAŅA7H;L 1ɺmIH5 11ҾHHL$1H߾1ҾHA$A<$Iu*Ht%H=P H@@@QLs@H@I92E1InHtZeIHMtL`H1ҾHHHHLHTfŅMM6I9uMLpHHH8t%H5HWoIHHIGL;I߽fI\$LeIHuM}&DLY`1ɺj1H5 H[]A\A]A^A_fDE1M}۹R1E1L H5: L_11xH5 M}L_1ɺ1H5 1YHd@L_1ɺ1H5 1%MLY_1ɺH5 1ME1@L)_1ɺL_1ɺ1H5F E11uDAWAVIAUATUSH8F8H|$D$F9HT$D$HtHD$E1HX@Lh@L9NDHkHWtXbIH2MtL`H1Ҿ*HHHHLHTcMHL9uMdLmHHHD$ L}H=lD$ HpD$$M IFtL1҉.IHMt1҃HL;H<$Ht1҃LY:MtSH|$LfHI9nf.AfL$UIHLͬ P 1MH5 IXLIZ1ɺ)H5 1&D$HD[]A\A]A^A_L 1 H5 E1ʼn$L-I1ɺ'뛉$LI1ɺ%눐AWAVAUIATUSHHxH $H|$0LD$dH%(HD$h1H|$ H|$ JHrQJEAIDHD$k1H1H$LHHD$H5)H=&ŃH HDA9DL11IL;l$G Ņ}HIuHZIH^HLIHWbIH_LpH|$HIL;l${Hl$ H;l$L5IL=%DHE11HDFHtHKHuH;jH}bIHtOH}1HLH$HHD$H5I LAʼnIE[E9EL11HmH;l$\WL vH5 1FMMW1Lؕ H5 A2DLQF1ɺbH5{ HL$hdH3 %(Hx[]A\A]A^A_@MMLH ^H51 AHL5L=#tIH@LHIHuhL訍IHtHx1HH$LHHD$H5 LAʼnIED9AL11|@Lc 1H5; Lt$Xt$Xt$Xt$Xt$Xt$X H0LD1ɺJH5 Lf.Lۓ Pf.DLܓ AfAVIFAUIATIUSH辩uH訩'H蝸Ņ[H聸FHߺAEkHA$芩tA<$L HH=D@@@QEMAt2H1ɿHL H5o @ P1XZA$t H@ AEA $tAULH5Ņ,[]A\A]A^@Li H5 11b[]A\A]A^L DFH[u/HJuA$AE1L H5k Կ[]A\A]A^fHAML 1H5 {fDLA1ɺ1H5 Of.AUATUSHdH%(HD$1HtkHHHt`IIH߾/蟵Ht:HHLHHM,$MtLHuxH$H]H!Åt*HL$dH3 %(H[]A\A]@LM!1L H5 `fDI$fHIٺ1AULy 1H5 !XZmf.LY@1ɺ1H5 =DUHSHt*HtH}Ht w!ÅtAH[]L?11ɺ3H5 }H[]@L?1ɺ61H5 Off.fATI USHH@HdH%(HD$81HHL H$EE Mt\H4o$oL$oT$ `BpBBtHT$8dH3%(HugH@[]A\HHBuH.uH{H1f.L 1H5Ì ,5DAVIAUAATUHSHHdH%(HD$1HHDHH蟛AątPDk H$Hs HTHHt\I^AHL$dH3 %(DH[]A\A]A^fDL=1ɺ1H5 WDH}HE1L=11H5  y1E1L H5 JHUHSHHHFHt H8HtBBxBpBhB`BH0tfEEH[]HHB$t8HPBHǃHBHtHǃPBLa<1ɺH5 ATUSFu []A\DHFHIE11H@2ŅtHC@[]A\f.M$Lf 1H5 dfATUSFu []A\DHFIH1MH@袕ŅtHC@[]A\f.ML$HL 1H5n ׸DATAUSFu D[]A\HFHE1HHH@@AątHE@D[]A\H{@Lx IH5و 1@ff.AWIAVMAUIATUSHHxH$DL$PH$L$HD$H$HD$HdH%(H$h1&IE @D$ 1L 1/ H5' 萷AH$HHD$H$HH$LH$HHL$MI}LmI}H4$H݉H<$<D$ )!H55;L D$P uLAL91ɺZ C 1ɺe H54 1Lў 蔶1LL$0; L4$LD$XH<$tLw H<$fL$PʁDщT$Pq H|$LL|$M At IK H$>HD$xD$hD$lH<$D$TV H$H;l$D$\D$(HD$hL$ L|$0HD$ HD$lHD$8HD$xHD$@Mt@LLk1LH8H1Lć 1AVBIH5 Y^1LD$ 1HLFHLHLt$HDD$xL$`LL$HAYAZHIHD$tIPHD$xPDL$`LD$H$t$|WA[ZtH|$xt4HGD1ɺHL2H|$x`D$p D$tukDD$TEPH<$?uH<$Ho/H|$HF1ɺHL賛LLD$ 1HH"LE11HmH;l$H]LeD$pD$tHƄ$ = H{ LD  Lp51ɺ?1H5 L|$0H5H=D$(o@H|$1 MtL EHDHD$(hL1L蓴/HIH:Mm1LĄ H5 .HH;\$(L;A?@uMwLj2I}L6I}Ht$H襄uL! dH5Q 躱L41ɺ> 1H50 虱L|$H|$g$$$$$$H0H$hdH3%(Hx[]A\A]A^A_f.I}LTI}H4$HăL< uH5l հML- H\H54 袰H;\$(xH<$ D$ rfDLLLELOl$Xt H|$b L|$LX LH5 2@H<$L L21ɺEH5C 豯H5H=3YD$(HmH;l$L|$0IGHt\$\X$$$$$$λH0D$Xl$(9MH|$LL6LY11ɺoH5 Z@H|$1IuDHt$0LLHD$0xtH@pMIٺ`HLA IEHH5~ 1P1^ZHYLHL$0LLT$HAAHD$0H@Ht@DD$\D$\AH5 H=11L=0MH5n~ ׭H5H=YH|$xD$(Hc@31ɺHLyH|$x觰D$(f.L/1ɺ9H5} A @L/1ɺUH5} @L舚 H|$xvLh(LXL/1ɺkH5C} 豬@LD$H$Iu LI}蟖~f.L.1ɺi H5| \L|$fH|$vD$TD11Lu.eH5| DH5%H= D$(D9DMDd$(@L).1ɺUH5S| @L.1ɺkH5+| 虫@L-1ɺQH5| q@Lt\H|$xD1LIH4L{-1ɺ 1H5{  LI-1ɺQH5s{ L!-1ɺP 1H5N{ 貪L|$LLpL,1ɺ H5z dL| 1ɺy 1H5z 2L|$3AWIAVAUATUSHLD$~rBII1Ll1fDIM9tA6LuIM9u1MtAHL$Ht)H[]A\A]A^A_111AWAVAUIATMcUSH~eBHL5z 1HDHD$fHH;\$t4;EA)fHcIcMIL1HTA9CD%H[]A\A]A^A_f.USHH>*HHa;HuHNt1}LH[]HSXH$H%H0#H-( ,@@HGH1LH Q I@GEHH< :H$9H%8LF(H=BL€H= L€ҺDH[]@H[]@fDfDfDfD tfD dfD TfD DfD 4fD$AWIAVIAUIATUSHH$@Ht$@H$H$pHT$HH$H$HD$LL$xH$dH%(H$1cٲIhH޺@Ƅ$p"H$HHD$8H$HHD$pDŽ$MtL$HD$HD$`HtHD$`HD$xHD$(HHD$(DXEt HxX$D$ L$`jL|$@HILMH$0HI9pD$$Ll$L%'!ʼn,$HfƄ$0IG@HHx IGHHxH蛱AŅkIHGXDT$E DD$`EG^tmL`uIGH|$HHpHvPIG1ɺ LJ H5t pHHD$PL1ݣIZYHwHH|$H2vIGH|$HHpHhuIGI~Ht$pHPHRvuuLu 1 H5t jDŽ$vf.^IGH@XH74$L$IOHT$@LHt$(tHD$(Pt H@@thI_1H5cs IL_ 1 転I~HIWHH|$8HPB\ %DM?I911{H$Hl$8H;\$8HsLTFHH9uH$H$H;D$8H$0Lt$PHD$0H$HD$XH$DŽ$DŽ$H$H$Ht$0@Ƅ$0H@Hx HD$H$Ht$0H@HxH誮H$HC@^@HpHH|$psHL$PLsD$dHA(Lt$D4HD$hEAiTL`(l$ ALDd$I ;D$ }TA]HEt5IGX/NdL~HpHLEIvHL?DH0I9D$uDd$A9 H|$HDŽ$HDŽ$HDŽ$HDŽ$DŽ$DŽ$pHD$  L|$PI_(5 E1D$=HHH,HPHHH,H`HHH,Ht A$-H$L$LHHH,H4HHH-HDIIII,HtA$-dHHL,MtA$-nHHH-tA$- rfI_(AD;5+ IcIIIA$ -I$,E11LM1ɺ H5o }L蓆IHGXLkIf.IGH|$1HrM?I95|;M?I9ff.VIhJX@[0IPDL$`EIGH|$HHpHoII1M麡 L H5m @11=M?I9q@LKA@I,II:IGH@XHH|2fD$HD$@1LH*qD$_fHL$hHLP Q H5l DIP1ATq9H Dd$dEtCH$Hx螶 L IH5l 1DŽ$@H$HH$H;D$8Lt$P11ԨHD$(DP EtD$E= HD$@@,t$ D\$`EL|$HI/L9D$Ll$@H}1]Hu1v MLT H5k AAYAZDLH5(H=DHmL9uD$1111ƧH|$x'f.Ht$(L#fDHt$E11LVfHt$E11L~qHt$H$L$LfDL$Ht$H$L+fDLY1ɺ H5j <@D$ELt$XfA@LA$-A)LA)FA)F A)F0"H|$H1AVI1H5 j Lp n^_D$D$EHD$XfA@LA$-)H)@)@ )@0H|$茳H1ɺ t$`I1H5~i L I,AYAZH A$-D$bH$HD$XfE1H\$H$DM))@)@ )@01Ld$htX1HtIsA@LH1HcA)H|$XHIcLh dA9~ÃuDLd$hH\$Ƅ$H$A$ -D$HD$ L5IN HtLpH|$3t$X1ɺ AVI1LZ H5 h 艗AZA[bH$HH\$Xf)H)C)C )C0/A$ -H|$D$豱H1ɺ SIH5g L 1Y^D$ fH$HLt$XfA)LA)FA)F A)F0蛎E$ -H|$Eu H1ɺ AVIL 1H5g Hr_AXH+- A$-D$PH$A$ -L5L HD$ HtLpH|$芰H1ɺ AVIL 1H5wf XHZHL,M/ A$-D$D$\H$H$HsHtL$dHT$(H|$PЅHsHLNH1ɺ# HD$HL?h H5e 1?A\A]H$Lt$(H|$PHpLH$H|$xt"IFHthD$$$9LÉ$dL1ɺ) 1H5Je 賔H5ʭH=8^D$EL1ɺ0 1H5e Lt$Pgzf9HD$ D|$dERH$Hx譮 L} I @LY1ɺ 1H5d DŽ$H5H=f11Ӡ11誠H|$xDŽ$HD$(H@Ht $H$($($($($($(H0$H$dH3 %(H[]A\A]A^A_1HcH[HHD$hHh(H^H`(~Ht$H|$PE11蚃H$H@HD$ AL$Ld$hHcHIHIA$a(I$h(HuEZH5c H=kHtLpH|$转H1ɺ IAVL~| .Li1ɺj H5b $@H|$ljţHBH|$HXNH1ɺ^ SIL0{ H5>b 1襑A]A^g@Dt$dED$$H 1t$`I1L} H5a ?XZH諫H1ɺ It$`Lb| DLQ1ɺ 1H5~a Lt$PHL$L1ɺ} H51a 蟐H|$H1ɺ[ ISLy D1L&HD$(H L1ɺw H5` 9H5MH=11(11DŽ$?H|$nH1ɺ t$`I1L[z H5Y` A^XD$Lnx H5"` D$舏DŽ$DŽ$H=aa4DHD$@HH`4HH$L+H9 H$0Lt$Hl$HHD$0ifHCHt$0H@HxH uLsDD$`IFL`HEu}|$L5 a4L%]`4IELL;,$IƄ$0HC@Ht$0HxH nL1ɺ= H5^ _JL}L9uu@M?L9eI?-uHLGuLH_LHCHE`4H@H@HH_4Lt$(HT$@H 5_4H|$LxAvtIFHHCH1ɺW Ly H5)^ H@LHHHD$H1}XZH5^4Lt$(H|$H$LH|$xt$IFHtDxED$$$9LÉ$twL`1ɺ] 1H5] H5 H={D$EL1ɺd 1H5F] Lt$誌DH5.^ H="HHcuDŽ$Dd$`EvDŽ$L1ɺC 1H5\ Lt$(?Lt$11%kH5yZ4H=^4MH|$@>ul$`uDŽ$DŽ$\$`=D$]D$觃D$lLsVIGLw 1ɿ H5[ pHHD$PL1@_AXAWAAVMAUIATIUSHHH$DL$xH$HD$(H$HD$`H$HD$hdH%(H$1 HC @D$ 苗H$HHD$H$HH$H$HHD$H$HHD$H$HHD$8|HC @Lv GHDŽ$0AH{Iu:LLX IH8@/HgIH; H$0LH؍L 1ɺdIHL% MM|$ 1HwHHtG/HHt5H1HyHHzMHLIIM9\ A4$fDLj H5vY 1A׈1L 1ɺAH5MY 趈HD$(HD$@H|$($($($($($($(H0DH$dH3 %(1Hĸ[]A\A]A^A_ÐMH{LkH{H4$HZ#ML{LIzH{M|LvIHJHM1LHXLt(H{Ht$LgZHD$(HD$@H HD$@DXEt HxS H|$tH<$D$ H5 HJurAH4 1ɺvH5W 1Ls Ht$11H b L<$LD$|H<$tH|$H<$L$xʁDщT$xE Ht$H|$8H$0ĒHDŽ$DŽ$DŽ$L$L;|$8D$0%H$`HD$H$HD$ H$HD$PH$HD$pfMwIoDŽ$DŽ$Ƅ$`MtHt$@L[Ht$H螒 1 H|$ L$L;l$Lt$HGDHPxHLHHD$XvuLLD$XL)I9 MmL;l$nMe/L{IHuHL}uH|$ MLt$HMIH,{HED$1HLhW H58U P1裄AYAZ1LD$P1HHHLHHH$PL$D$$sY^HIH$HPH$PD$LD$H$$p_AXH$t7H 1ɺHHkH$$ $uzt$hLE1Lt$hHLL$PHT$0AXZAH=H5U (H /1ɺHH6kfDL`LD$P1HH H11M?L;|$8$X$X$X$X$X$XYH0D$|Dd$0D9DMH|$( Ht$@HEAGAIDDd$HHD$0H$0HD$@@HT$@HHh8/I|/HxIH$0H{LHH{H4$HTH{L$H{Ht$HT1 IL;l$0 DŽ$0Im}@HLeLdH{LH{Ht$H/TuLS H5Q ACgfDIA?/tLHÉIHWH{LKH{H4$HSLsLHsH{HlH_IHHM1LHAHmH{Ht$LPSLR H5P A`H<$AŅHD$@DhEDILX H5P 6fDHM=IH@HT$HLAgLDODd$|H|$L1ɺfL$0H{L褜H{Ht$HRLQ H5O A#GfDH{IvKH{Ht$ HQL2Q H5bO ~H5H=RxD$0Lt$HLd$fH5H=8D$0eL1ɺ H5N I~5@L1ɺH5N !~@11L]H5N }H5 H=y蟽D$0H$Hp1ɺHHe.H$D$0L@11LH5M _}DH=H5n D$0HD9DMDd$0HjL葖@LQ1ɺH5{M |@HXjH$CfDMH{LH{H4$HSOLoH$0IsoH{MtLIHvHL$01LHLgiOH{Ht$LNwLVN H5L A{fL%N f.MM 1LW H5/L {D$HLD$8H$Hs H{HL$}eL1ɺH5K A{@L1ɺmH5K A{bfD1H辽HD$@HdL91ɺFH5cK AzfD|$HL1ɺ 1H5+K zD$HL1ɺzH5J A[zfDL1ɺ1H5J /zZf.HHLQ1ɺLH5{J Ay2fDL!1ɺH5KJ y@IH~IHL$0LUf 1H5I AZy~DLhLtH{LpH{Ht$HKxLWK WH5I Axf.LB f.L 1ɺdH58I 1Ax@L f.L1ɺH5H Qx@HetLH$译rf.L`J H5H AwL91ɺH5cH wMLFPRH5:H AwLI H5H AhwL1ɺH5G Aw#@Dd$HAM@LI 1ɺ1H5G AvH@L0I H5`G AvL 1ɺpH5;G 1E1vLH H5 G ArvUMHAUvL QI Lb LDH5F 11vA\AA]K-nff.fAWIAVIAUATAUDSHH8H$pHL$H$DD$ HD$`H$xHD$hdH%(H$(1~1LH 1H5F }uAH$AMHDDH$D$AHD$yHqH$HHD$\H$HHD$xGEaAD$D$pL$pLl2fI~LI~HHGHI9L;1LLiH$pI9uHtL~LI~L讑I~Ht$HGuLF H5D 7tD$pLx1ɺ1H5D t$8$8$8$8$8$8oH0H$(dH3%(D$pH8[]A\A]A^A_fD|$pnIF @tH|$HH|$D$(DŽ$"$ uLMHT$Ht$xLfH$H9}AL|$5oLLAMoAU(HH9t~I~@襐IHYIHsLFIEHuH{ADHLKLE PH5B 1QrHAXAYH9uD$pAH$@HH${~DŽ$DŽ$~H$HD$0H;D$xhH$`D$tMHD$XH$HD$PD$($DŽ$HD$0DŽ$LpHXƄ$`L5 HtHt$X@HvHt$XLQ~! LD$P11LL  ML[D 11lH5A pHHLDŽ$LH$P$D$L$%`IAE1HD$PZYLH$PH$PH$$X]^_ $$D$<$$HD$@HHH$pH$||H{hH@Ƅ$-]HD$`IH|AD$t I|$HcHHH$HD$ H9H$AL|$HD$HD$ 1_nAZA[DL$(Eu H|$wtH|$i118{HD$ HHD$ H;$HD$ HhHHt$HH@IƄ$L 1ɺH5J> mcML.FH5"> mD$pfDH|$IF DT$ 1D$(@E!H|$$fH5lL1[Lb1ɺH5= lD$pDL(? H5X= lD$pfL1ɺH5#= lD$pv@L1ɺH5< alD$pF@Lg? 1H5< ,lLu1ɺH5< 1 lD$pfDH|$H|$1Hs@zH|$HHL_HU@H$H;|$pH;W?H fHHH9t!HH;D$uE1DDH;OH?H;|$u$ADŽH|$HHLVHMLp> 1P H5; 1jA^HA_LHH|$HD$hЉŃu H5^< H=RxX11LH5&; jH5H=:A9DLfD11L|$L$bw119wH|$` $$$$$$vH0AH5; H=訩D$EucHD$@HtYHu HD$@1ɺLHQu&L1ɺH5: iH$t7L%1ɺLL;QH$flH|$@\lLD$P1LHL|$(uH|$)11uHD$0HHD$0H;D$x($hM$h$h$h$h$h.uH0|$t$%H|$H$H;l$MLd$HoV H}~IعIH58 1hHmL9uD$p$L=V 1ɺ1H5r8 E1g11H$}HHx HL}IH | AEbt1#HHHHLL$ ~1L: 6IH57 14g1HL$`HLHD$hЃDE$WHMPLT 1H5s7 fZHYFfDHMPH5<7 1L.T f^H_fDHMPLS 1H56 \fAYHAZ@#fDsHt$XI~ 0sL\1ɺc1H56 MeH5H=q藥$h$h$h$h$h$h8rH0D$t11H56 L{e\$pD$t$9MÉD$p1H$#L$HH$fH$H$H$L$H$H$I$H$H$/HIFH$LH$I$H$H[H$hH$xHH$H$HH$H$HH$H$H$pH$H$HDŽ$)$p)$)$L$H$DŽ$H$H$0LLeL$@L;$sLd$(H$1H\$ Ll$H$fDIOHL9t&H;HHDH;JPHL9u$BM?I9uET$pT$pHH;D$)@H5D|H=آD$t#LQ1ɺH5{3 b@L)1ɺr1H5V3 bH5{H=Ag$D$t"L1ɺ1H52 L|$L$ZbH5n{H=11Io11 oH|$`$$A$$$$$nH011L0H5a2 aDH5zH=NtD$tD9DMDl$tL1ɺH5 2 yaHD$`IH1LIHnL1ɺ1H51 1aH5EzH=٠11 n11mLLHHm!@L!1ɺ]H5K1 `f@L1ɺH5#1 `I@LNH$y fDH$H|$vMifH;OH?L9uIF @IvLM 1ɺIH5|0 1_IG11HIHCHHHLHD$LHD$IGH$HL$Ht$H$ H$hHo$Hof$XHL$`HT$(LHt$ HD$hЃE褹|H$fDIGLH$H$ H+TAAWAVIAUATIUSHH|$H|$ H$HL$dH%(H$1&hhI~hH޺@Ƅ$I/IIH$H9E1Ll$PLt$DH{'LHLh践HSLHt$H|$HD$AMtID$Ht@DEH5, At(H5p+ 1ɺH1L#ZH5sDH=MsD9AL11gHH;$D$PH{@L(L1ɺ<H5* YZ@L1ɺB1H5* *ZH5>sH=ҙt$Ht$Ht$Ht$Ht$Ht$HfH0H$dH3 %(H[]A\A]A^A_fDDMtID$HtHf1ɿL4H5* YIIHNf1ɽ[Qff.UHSHHAt"1HHt*H[]ÐH#AfeL$1ɿH5S) XH[]ATUHSH@H߉Ex@1Ҿ3H߉EvO]3HߺRCHHE@z@1ҾHSEX`HS@t`H OAą*HN1ҾH߉E RLF 1ҾHAoRLF HE0L9Y1ҾHRLF 01ҾHRHHE8L9H}0HHt-HHt HHtH1HH91ҾEHRLF 1ҾHQ1ҾEHQHEPH`HMEHHH߾AAT$@uHD$PIT$8HH9upH6H9aH;VuH|$ԠLD\$0JDEH{Ht$0bID$0L1ɺ1H5  sEI~\L, IN[L8 1ɺIH5 1#EANTI~[7L I[LS7 1ɺ0IH5g 1DANTMfLIĨa[HL7 ATIH5 1DY^HH|$uH|$(薟)LL 1ɺ1H5 =DI~ZH1ɺLd$PI1L;7 H5 ATDANTH{LXZ-aIFHL$Ll$ L;d$ t HIT$1HHPM$$M9utA0u1ɺ%H5 1L7 uCHHT$ HDMM4$ML9HLIIMLL9II$1HSLHuH{xHLKL$ PH5i 1-BXLZ衝H|$LI~YYH1ɺ$Ld$8I1L4 H5 ATzBANTH{LAZA[_IFHTL〣HztH|$(lS H|$Zu |$H` D$0MI$ML9H\$PHL|$XfDH1IH HHHtHHt$EHt$AD$T  tI|$HHt 9HIIH9mHI|$L-7tLWH1ɺaAUI1H5 L@ AIt$A]E1A_HWH5t 1LF5 Id1@It$Dl$0I|$aWL 1ɺiIH5& 1@AD$TI|$'WL4 IH5 1P@H|$LCL AT$TufDHuEifDHA}PLW1H5[ ?YL,1 ^1ɺ~H5: 1?4L1ɺ1H5 {?H螚H|$@HE1fE_Et_H\$Lt$@IH$DL$L9u-f.HL9tH{L,7uHHAE9owH\$IHD$A0MIH՚ML%w3 ImL9l$M(FHEIIH;l$HMNM1ɺaH5 1IPV>AGIVE1IvAVHPEOsDAYAZuH|$LyH|$H LU11JH5 =VH|$H٘L"11H5O =#Lۘ&޲MImMM9u!fDHEIIL9HI}9tI}SL 1 1ɺIH5 1(=H|$(LL|$PH5m-H+D$0H\$PL|$XH|$ ^|$HSL1ɺG1H5? <;L1ɺLپ1ɺH{Ht$HHT$hYHT$hDL$0HB0EL1ɺH5 "- H5d 7H|$L4M1LH5+ 7H|$L臒MLv, L|$MMI.MM9u_fIvH$Mn軍1L- MH5 @117HEIIL9tEHI~fuMNL, H5S 6H|$L译L$L%~, ImL;l$(HLIXI}蛬IuL_Mm1MMH5 @11@6HEHIH;l$(tEHI}uMML+ H5 5H|$HLHH$Ld$ H;l$ tH}HmL9uIL% Ll$H9l$t6HC(Hu1ɺMLH5 1l5HmZYL9uH|$臐D$D$L/) 1H5 5Lc1ɺLP1ɺ1H5} 4 L 1ɺ51H5W 4SL1ɺ:H5. 4/MLH Y1Lh IH5 1U4HEILIF莎IFHT$P1E1Lo)o`)bHs)d$0蟝fLS1ɺm Ln 1H5j 3H|$LƎL 1ɺ1H57 33M(L xH5  t3z+f.AWAVAUATIUHSHHLig_HL IL*HH?MuL%HImHHHpUX1MULm+ H5E* @11Ƀ2H[]A\A]A^A_f.#HHHHD$L1LLT$MuMCLLLT$#&L) ,H5) 1LT$L$L31ɺAHHGL) udH軩uGH HLӳ1ɺRH5) k1L) K1H5( <1H[]A\A]A^A_Li1ɺD1H5( 0H[]A\A]A^A_L[( 1 H5e( 0L+( 1H55( 0M&1L( H5( a0LT$LD#eff.@AUIATA1USHHdH%(HD$1H$rHHHHEցHDE1HuE11LPHUjwH H<$A"1蚁HHtHL$dH3 %(Du8H[]A\A]ÐL1i 1aH5& AV/_'f.DAWAVAUATI USHXHt$dH%(H$H1 AHHI6LHHJ1H;Hl$@ HL$0L|$8Ll$HL$Lt$(fDCHúHHs Y$QHL$11MLHl$(hLl$(LLp&uHAM1t$8Ls' H5 ' ".HD$ XCZpLl$A*D$LE11'H5& -DL$LDL$DL$H$HdH3 %(DHX[]A\A]A^A_Lٯ1ɺ,1H5[& o-E1f.L1ɺ#1H5+& ?-E1s1ɺ9D$LiH5% Ll$-DL$(fD1ɺ>D$L1H5% Ll$,DL$fDL% 1ɺ01H5% ,A$ff.@ATUSHHdH %(HL$1D$vtrHetaHTL% lH5$ 1A+HL$dH3 %(D8H[]A\fLY% 1YH5$ A+@H1H0-HHhxHEHFHt$H=DL$EH5HA:01ɺHHHHH`H (H߅H'!HA@DHHH1I麚L# H5U# @11c*H+1ɺHH1AH5W "L11L 8H5  !sff.SH 9CPtH߉4ÅtD[19L 'IH5 1X![@1L1ɺ,H5 /![ff.AUATIHUHSH8dH%(HD$(14ToUho]xH]hH)$)\$ AŅHHH9t#HPooKJHH9uHHLA8Ht$(dH34%(DuuH8[]A\A]f.1E1L H5{ ) LL 1H5G xff.U1HSHHH9wR1ҾH;H5*ÅtgHwÅH[]H߻;L\ 1ɺzIH5 17H[]fD1Lo1ɺH5Y H[]fDH߉ƻy;H1PL1L H5 XZH[]ÐLL  1H5 S1HH߻m0t [DL11ɺoH5 -[fS1HLH߻.t [DL711ɺdH5 [fAW:AVAUATIUSH1H, 1Ҿ7LH HtuHtpLNHL€uHƹH=:LMu9H`"wL-LLMtHtHLLDtH88HPAŅHH="HHdu-LMHHC`L7HC`HHLSu?L1ɺ1H5p H[]A\A]A^A_f.HL5HLHHc`HHHǃH9tHPHHǂH9uHLHHD$I9tGMwLt,HH=AuHIM?L;|$uL=VHLuK,DHHLHǃݐHLuOHL=H;l$t,f.LmLtMHmH;l$uހc,f.H8HH(HHt&H={uID$(xz~Hp1L IH5` @11ɃH[]A\A]A^A_@HtH=JHI1L_ H5 bHHHc`LHǃH9HPHHǂH9u@L1ɺDHC`@H1H5S IAUuL Y^YfLL 1H5 qL-ILDH1{ULLL H5 hXIZLl }1H5 ?f.HC`LIL H5M fDI$HǃHt H{H 5H0H`L葁kH`2L IH5 1vSff.ATUH1SHHX HtntgL%X ,fDH{?t_Hu6tzH[Ht9t2tL 1CH5+ H[Hu[1]A\fMH1H5 fD[]A\ff.AV8AUATUHSHHLadH%(HD$1|1H߾7HD$Iu.HT$dH3%(H[]A\A]A^HLMtzH=_Lu`LHEmLH-uLLL 1ɺpH5 c@fLH 1HL$HHےD$tA$HH=&uAL$1L91ɺqH5# 9HHHИzL1ɺtH5 yVA$HH=s#AL$fDL11ɺkLi H5Z  fAU~ATIUSH1H`LHEOHLHHL _}I$uUHtpH td1H5 1LY _L}t!I$HHK LU11ɺ(AULL H5> HHXZ`8H(HLi1L IH5 @11ɃH[]A\A]fHEI$HH1H5 IPL7 16Y^L1ɿ1H5e Lv  L/H1HH= /\XZAWAAVIAUIATUSH8HdH%(HD$(1D$$A!ˆT$Ht.?t)IHt>tt oDAA|$MII9tHsL脲HL9uLdBÅ"II9ufHmL9H}ztH}G[@uܾ*uΉD$ HML SH5) A\A] AF`%AMLެL@>D$ qhII9qD$D$D$fg+H]HuA@H]7H uCYuoHucHCXuXuQ@uJL DH߉u,AZDHLD$/D$fHmI93gDL$EtG|$AD$L ǴL  H5 PH LD11@ _AXt$t |$ZI>L$LI??b1AمL H5& @H11U XZHL$(dH3 %(D$ H8[]A\A]A^A_H(@[yHHifDH`QCHa3HHCXA@Lq1ɺ\1H5Y  LP1ɺ 1H58  D$ fLL1ɿLH5 I>ufMLj 1H5 e YHAA1Ly H5 11 []*`D$ `HL$$LLrD$ _HxLN H<H5 HD1ɺP1ADL$4 AZA[fDM1ɺ1LI H5 x D$ HLCXLW 1H5t " D$ ND+dI>ffDL91ɺH5 D$$ff.@AW}AVAUIATUHSHdH%(HD$11ZH0E1L sHutLHAHL9uEtVLLպI^1L IH5 @11HtV1ҾHLHjJHL$dH3 %(DH[]A\A]A^A_f.eHKHntLD$j:=YHE{LHhLC1ɺH5( DHYCL1ɺH5 M1ɿ1H5 L XLHL1ɺH5s &Lo1ɺfDLY1ɺ1H5A X[[HL$LHH%)A[MDt$HtHD#\1ESL H5 AW@11ɃfXZE9L1ɺFL1ɺ3@AWIAVAUAATUSHH;+AH HA_H^ HHt&eHLR  -HMHht6KHW1ҾHPYH!t&}HLO nHt)1ҾHLF 4Ht)1ҾHmL4 HvEuAD tEtH;tt ȀHtHC(@w[~RA1HjEIHHHD1PHEE1ATLjHJH LH߉GH[]A\A]A^A_fDDHsfD}HSfDH+%H HHH HHD L H5 1A@H[;DHF&_H1 H1@KHYHeHE1AYH\xfD1ҾH z@H[H=$ gJ%L D$ H[]A\A]@1LB3 H5 taf.SHHptHĂu;[ZLt{1ɿH5 [Hx^L AH5 1f.ATIHUHS*tfH. HfÅt HLH( []A\Ð1LK 4H5$ L[]A\DL  1'H5 []A\ATIUSH&u2HHE1PjjLHE11?H []A\@HAHH HPjjAWAVAUATUSHdH%(H$1L$HILL2sLH芞I1H߉$Hl$PH$ L$bzIHHLt$PL$\LHqmIH5"HZHT$8H5H.~HnH4$1ɺHk@Ht<H<$1mH1H8IHLHHT:HyH4$HȣHHH@H@@YtHEHHHEXt$Hlt$Ht$Ht$ HHt$0Hst$(H'_ HLHϐIH9D$t!L 1ɺ1H5R IH9D$t!L 1ɺ1H5! HtbLk@L{@M9tUMuLt01ҾLHVHH3hMmM9uHHHT$81HHj H<$߆=H4$1ɺHLL5 MLiJAUL+ AVMH5 11ɃXHZ脲HLH8fH$dH3 %(H[]A\A]A^A_fL H5u .H<$ׅoH4$1ɺH0L=u1ɺY1H5 NfL u1ɺ>H5 Lt1ɺ@H5 qH<$QH4$1ɺH,L $1^L H5X  fLIt1ɺz1H5+ H<$薄H4$1ɺHtWHLH6f.L $L]vQH5 jLs1ɺH5 AHH TLks1ɺ]H5J Hv1g LH5L s1ɺiL s1ɺXH5 H1 u1L.* cH5 `Lr1ɺH5~ 7L{r1ɺ]H5Z  LWr1ɺXH56 ZL3r1ɺo1H5  H`HM`VLq1ɺ1H5 Lq1ɺH5 VrLq1ɺH5y 2NLs H5T )LL$8Lq H5/ H軖H}Lq11H5 1Ҿ7H.1ɺHHI9lH5d]HMH5LzH5S LcDL H5e 11qL-mMLGp1ɺH5& HRthHFLDL H5 11HsL H5 kLo1ɺH5 GtfUHSHHVt HZ tCH9uEH߾(HuI-HuKHH[]Hx2H[]@4H[]H,50E11jE11HHEX1ZL* +H57 1H1HHH $Tff.@ATIUSH6tjH%u&HuH;L|F ;1H5 []A\DH HMHH|qHgHRunHAu]H0u}tHHHE11PE1LjHj2H DLE Hf.LH[]A\HML ]L= Rf.@AVAUATIHUHSHS;HtjHLL9tWL5EDH{7t6Hs1LL"Hs1HXLՍMHL9uHHM`HHDžH9tfHPHHH9uHtPHtDH?1L 9IH5T @11Ƀ[]A\A]A^1LGk1ɺ7H5 []A\A]A^ÐI1L H5 []A\A]A^H{HL'PL 1H5 _XZJ=fDATIUSHu&RH=tH,u8HHE11PALjHj/H []A\1L IH5 []A\fHaL' DH5 YfAVAUICATIUSHHi]t H}HH裂CL.EH1ɺpML! PH5K 1XHZ@tLH脙t@;=1MuL H5 @11Ƀ[]A\A]A^1Lh1ɺsH5 O[]A\A]A^ÐHX1LH=l o0HX[]A\A]A^A_fDL 1H5 tDHdHLmIfLc1ɿH5 !NLTc1ɿH5p HH%11LcH58 f.LL 1H5 |}f.ATIHUHSHwHg/Hc`HHHH9tHHHHH9uHdtxH訒tlHX61L 1IH5U @11Ƀ[]A\@I$Ht H{HHQ1La1ɺ/H5 G[]A\DIL 1H5 []A\I L f.ATIUSHu&HtHuHHugHHE11PALjHj/&H []A\fD1LJ AH5 ,[]A\fLy 1ɺQ1H5 lH!L <H5e Tf.DAWIAVAUAATUSHHdH%(H$1Lt$@Ld$`D$$H$H|$HH$PH|$HHD$0HHD$\7LT7H\_fL)D$`)D$p)$.71HH߉$ Ј$H5H߃$ Ј$HbH"$E$AELMl:fDHLxHLHU6L9HHuHIHuLML H5w 1H_H$dH3 %( H[]A\A]A^A_Ðt'HV>fL9 1ɺ1H5 /$fHl$`L9t%fDHHU1HHPHmL9uL 1ɺ+1H5 H-ĀLHHuLl$`M9uL@MmM9HIUHHHuI}I}H HL6 UI;H5 10]A\oLi\1ɺH5 CHl$`L9u#HHmL9Hu1HZHH\HtH|$xHuH{HHD$xHuL[1ɺXH5 WfL[H5 .}LJ 1ɺH5 $H}LL< IH|$xHl$`L9tfDH}tHmL9u1ҾH藍11L H5& oH1jHHfDHH IHtzHD$`L9tL;hu L9htHL9uHLhHL;2Lj ZH5 1H/L 11H5J Hl$@L9t$DHHU1HHPHmL9uHLHWrHt$11H[HQHyHH|$HݎHH1iHt$H|$1L=% Ll$0L;l$uMmL;l$twI}Ht$uHL$H|$LA辀yLs AUULL$(fDH|$xLB `VH{Ht$`LiX1ɺIH$HvL_ 1ɺ1H5 Hl$@L9tH}rHmL9u1ҾH诊1ɺ1H5Q L 1ɺHH$gHt$x1ɺHKL1HpHE11HD$0H߁PH$LL$4AZA[HHDL$$EHD$PHHD$#/H t$1HOLLM9E1 M6M9I~X IFHp@HE1E111HMtIFAHx@Lt HIH5 1!LL$x1Ly H5 H|$xff Ht$x1ɺH»& H$}fM H$1ɺH莻LU1ɺH53 1pLU1ɺHL$xH|$1H1nHL$xH|$H 1DCLL$xL 'L7U11H5 HJLU1ɺ/LU1ɺ1H5R L$L IL LL$xL vLL$xL H5 ]LL$x1L H5 HH|$xdHt$x1ɺH誹H$edH$1ɺHvBD1L H5 R1L H5 0HXH|$xcHt$x1ɺHH$cH$1ɺH辸HLS1ɺH5^ 41LL[ H5& o91LL] H5 ALR1ɺH5 _H苽1|ZL@R1ɺH5 !HKs1&D@UHeSHHFt HZqu&HH{tJH[]fHHu˺L81ɿH5 貵L71ɿH5 艵H[]ff.ATIU1SHt5HHLPHAE1j1j)H []A\@Li71ɺ"H5* []A\ATIUHSHH2It&LHHt []A\[]A\ff.AWLAVAUATIUSHXHdH%(HD$H1I9IL-y HL9t5HC@[tLHHM1ɺ>H57 11 HL9u˅AM$1LM DH5 dzLX 1EH5 裳L| 1GH5 L 11HH5 ^I$M$L9I HL9H{H@t d7ttA$=H{@L,/HA$11H5 M$L IJHCY^H)1MA$Ls H5 }XZL41ɺO1H5 1XHL$HdH3 %(HX[]A\A]A^A_Ly41ɺ"H54 LHA)$A)$UH{[fLI 1H5 謱,?訩AWAVAUIHATUHSHLqHt$:AuHLHHAFHdH[]A\A]A^A_DA@LH7LM9u*fM$$M9I\$C[tH02H@@C^IL˘t CYHktH1ɺxH5 IL 1U1ɺHL%;L21ɺ{H5? 1Lc21ɺH5# LKHq1L H5 ȯM$$M9LHAFH\LL$1L H5 lH[]A\A]A^A_AFH[]A\A]A^A_@Ha Li11ɺfH5$ @HLL)11ɺlH5 ff.AWAVAUIATUfSHH8dH%(HD$(1D$$HD$蛖AsL AD tvIHctL0 EtGH-LT uEtvL| H5 1躭HL$(dH3 %(BH8[]A\A]A^A_DH賕L D tIu1HH5HHD$[CH1HIHHD$IFEHD$qH1E1HQA1HPAVjHL$(H T$$u+D$ D"LHf1LL$LE @H5 11ZL1 hf.H9uE1HPIUAAVHL$5Y^VLI.1ɺH5 ܫ[1LL$L @H5 11蚫DLA 1H5 gmf.AVfAUIATUHSHH0dH%(HD$(1)$)D$HAHXHtHHQ1HHdEuHt4HRHL<4HHA'HL$(dH3 %(DH0[]A\A]A^Af5b/1A1jHHLL$AXZA*Lh,1ɺ?1H5# vfHHAAƅEeH<31DH= L 11aXHZ tHt$LHLH\$hHHD$hH9uMLd$H\$(IHD$hL9t{HD$hHD$0DMwIFXuCH r<Āu7H%r0H$r)@u" uH0rH-fL|$hIHD$hI9uLd$H\$(MIHD$hHD$hHD$8I9Ld$(L|$Ll$H\$0@Lt$hIHD$hI9I^HCXH rĀtIHtHDHLIExHAqE1H4vHAH| HHt L9zPAHH9uIHbHHAIHL9xPE{I߹1MOHLd$(Lh H5c Ll$H\$0ʎL1ɺL1ɺH5 葎\@L1ɺH5 i@ML 7H5ϰ 6Ly1ɺ[SDML <H5 :fEE9E9HL$8H|$LLcL1ɺH5 Ld$(Ll$H\$0mL1ɺwDML GH5 jLd$(Ll$H\$0MIHD$hI9WHD$hLd$(L|$HD$8H\$0(H%!Lt$hIHD$hI9 I^HCXH$sHHH MHLLD$L`LLD$u HH LyHMt M9|$P_HYL9xPOM9VMt M9l$PFHL$8LLLL)1ɺbH5P Ld$(H\$0跋L1ɺH IIHLD$L`LLD$IMt M9|$PX HL9xP~M9 MtID$PI9HL$8LLLGLU 1ɺvH5| Ld$(H\$0'fDL! 1ɺ=H5H Ld$H\$(诊L 1ɺE1EMLE9IefIIE1HD$8H9Z L|$@Hl$HLD{LE1Eu& H(AD;cL DH@HHЃ8uH@LxLHuLH|$L LLd$H\$( L IH5 1}L 1ɺHL LH|I1HID H9HPP1L9HH9tL9tfHAH9t H0H9u1ErIEML#@L1 1ɺOH5X ɈH31ɿ1ILs H5t UH='2@HuGAHˉDApG11uE6AT1ILr AV13H5pt IUX ZHuG1HL$HAAI !I IM Ld$AjDF111uH1?h3ÅL =3LRt 1H5s AfEtDAHH DH HH H9T$8pAT %AVH-;=3ILs H58s 1RP1UHH ;?ALe8>$H n@H HDHIٹPH Lx PRf.H5r 1AH L1ɺ&H5r 1UL1ɺ1H5ur UH-I<31ɺ1LH5Br UoD@H-<38BLm=$IٿH p?H HDHLPH0H5q P1RAH f.@Le8p=$H ?HJ HDHIٹPHLPR L1ɺ11H5Aq U?H-;38Le<$IٿH }>H HDHLPHlH5p P1RAL)11H5p H U?Le8h<$IٿH =H: HDHLPHn H5Wp P1R9ADH C11fqL?ff.HW 126HH:fDSH:1HH 6H[9ATIUSH_Hu+NfDHtH{9HH9Ht%A$Hk H{u9f.ID$ [ID$]A\fAWAVAUATUSHEuH[]A\A]A^A_IDEIHIIYŅu+L 831ɺ1L\H5n AL8EMLHHLcxUrL H!%tLLDHJHDщHL)HVA$LY83H1IAULo 1H5Dn AXZDfu DM rfAUIATIUHSHt0L5AEK5A$K5EH[]A\A]ÐL 7311L H5m AH[]A\A]ff.S1bt23t4H5K51Htغ[f.bK51t19[ff.SH#H{Pt]HtH{6H{6H{X6H{`6H{h6H6H6H[6D6릐HGPHtcHD@ J5DJ5Ht:HIHAPLLFQDH1=Hf.HtHt'HHHFHHFIHFIHF HwHuH1HII1@SAHcLHHQH5DŽ$DŽ$fDALJMgAw DHDa Mt8H\$KvH 6/zL Ld 1H5f_ Mc7AAw%DH%,HMII@IXIGpH HI`IhL@e  (E1H9L9EIB܅tDHۃuH޿.IH KvH 5/A4A\$ AD$8HP A$P@AT$AD$53McO0uNAO8tF<5D9t;H1ɿPL\$1Ld H5^ ALc K<5EO0XZDLe EIcG4IAL$HH H%H L ID$(=<5IwIHE7AI|$0-H:I$H-AuAL$EOxEt1=;5 L\$Ld 11H5,] AEG(EtAL$At AL$AtAw AL$At6=(;5w$L\$Ld 11H5\ AAL$AAt'=:5Ld ZAL$@At=:5,(AL$AG,AEl$I$8AD$ ] HDJ IIwXHtLV+Iw`HtIGpI~I=+IwhHtL,+AAo|AD$LcA  AL$t AD$LcE1HD$I_`HHD$AD$ D$ H HߺDL$H5-Z N*LcL$HZ HDIGpAH Z HlZ AEHD$(H~(H5w(HEH  EEEHD$pHI(A0HEEH Z HD$hHY HDEHD$`HY HDEHD$XHY HDEHD$PHY HDHD$HAHY HDHD$@AG(HY HDHD$8AGxHxY HDȅHtY HEHD$0AG4LڬtLt'HHX MGXH-P'H$H9&L?'HT$xMAIt$0M$Ht$H5EX O IH'HDH$RT$0RSt$H$$$$$$$$Q$$ASPH//$N 1WUAPLc ARAV$VH5X H$Ӌ=^3L1H$jAÅEA/H$AHH5 AI|$0 }A/AD$H\$1Lc FH54X AAE1tAG.A AAH= e HcH>H$H EG0E%bH- L%#HIL-U !HHfH*HHHH€tԹHL€tHL€tHL[OL !31ɿLnRH5W AHW*HoH'$ ?HHXHtKHIHt;H8t21E1LAEAD܅tILIu Nu1HW|fA,'FfANH / 3Aw0AW4HL$LGL tL #HH=f"HT L`#LT HL$H P#MIEHSAQA1R#WVH5U ASUAPLZ QAMc7HPAugH$t\H$9tOuKID$(AOMH H HDHLPHOH5*? P1RGH 8HILJ9 MwAU1LC jPH5> 1ALKH31AZ1A[kL$> H5> H3LM1L> lH5> 1 ID$PLIGPID$PFkA4IA09I`Ht.E1LD H@HA$8E1Huff.fAUIATUHSHHdH%(HD$81&HHMyLAH%C0LH % ЉC4E HHfATAUHSHH=t5Ht'HDH9up[]A\f11HH55HuH2H 8bLt= IH5< 11f.HI2H(8HIٺPLA 1H5< XZ1[]A\fDSWHu 5H,`H[AVAAUAH5tATE1UHSHdH%(HD$1lHt-HHHL$1HH5t6HuBHL$dH3 %(DH[]A\A]A^fDD9,$uE1D9t$A@H12H8}IH Hؾ HDHLPHAH5f; P1RdH Wff.AWAVAUATUSHH $H<$t$HT$HL$dH%(H$1=h2u^t1E1L `2Lo; H5: AH$dH3%(DH[]A\A]A^A_fDL$1H 2H-; LCuLL- HHHD$ HD$fDH(HL`LLtչLH=tMH a2L1HN<ŃLI21ɿ1ML^H59 AHHgfDE1H%H2Hn8M1PH;LPH5B9 1XZlfDT$4$LHT$LHcƄ,ADžD$8%=@LHHfDHHLXLLtչLH=ZtLH=(9 tLH=tLH=iLH=OgK H=L-H=@iLH=8 LH=(LH=ȺLH=hL H=8 LyH=7 L[H=gL= H=MLH=7 LH57 LL\$mL\$1MH 2Hl7 LMML\$|T$4$LL\$L\$H|$HT$LHAu%EHH2H(8R1MẾPHX8H55 PLx1Y^H=2H8$MH H HDHE1PH7LPH5j5 1RyH HT$H|$LAH2H(-8M1ɺPHu7LPH55 1AZA[Ll2MW1ASL]: 1H54 AAXAYifATA US1HdH%(HD$1f|$D$xwHt$߉<L21EU SL}: H5'4 AXZHL$dH3 %(H[]A\Hq2H(8BAٹLs9 P ATH53 1Y1^D8H"2H( u"HAٹ ATLX9 fDAٹL9 P ATDU1ɉ1S11HWxCHL2A1S L9 H53 AXZH[]@Hi2H8:AH52 PLC9 1 UY^1H[]fAWAVI1AUIH=GATUSHdH%(HD$1Ld$ŅL)Ho|$ftߺM ADžf|$tHAL%z2L;: P H51 1A$1D1AYAZ11 DFP 1AWAL9 H5w1 A$XZt LN}1ɺ 1H5O1 A$E>A]@+8@ L%2I$^L 9 IH50 1Ӊt L|1ɺ 1H50 A$AE16L 21L7 H50 AAE1HL$dH3 %(BH[]A\A]A^A_f.L%2L7 1 H5 0 A$7L%2L7 1 H5/ A$E1fD\$zfL%I2L7 1 H5/ A$M4$8HELy0 P H5m/ 1A_DAX {PM4$8EH57/ PL4 1SAY^=fATUSH0 F2dH%(HD$(1x.(2xRHD$(dH3%(H0[]A\H1122yHHtuHHHAHAąL 2LP7 1! H5>. AH}H5[22fDH21ɺ 1LyH5- L$7 1) H5- 2L 12 11LA6 H5- A1HH4D%2L 21ɺ7 1L6 H5F- ATH8H211Ly H5- fUSH=M t¸yIٹL7 zf.UH/SHHHgHtRHߺHÅu,I 1Lv2L6 H5* AH[]HIH 321HЉATUSHH $HdH%(H$1HHH+11H1Ņx/H$dH3 %(H[]A\f.H2L 8j<$IٿH H@ HDHLPHH5) P1RAH iWQAWAVAUATIUHSH(Ll$hT$L$DD$DL$LHHHD$:H4t L52H2M>I9 fDH|$HR"HHhHPPD$LHHT$C D$C$D$C(D$C,D$`C0D$pC4D$xC8$CLD$CH$ HT$LHSHPHsHH=2HC@Hn4ULHH=x) fH([]A\A]A^A_fIvL$IMI9IA~uѐ_L5p2Hi2M>I9IvLt'DIMI9IvLIzuLH=( LD4 4 4`L52H2M>I9uEDIMI91IIvLuLH=F( ?L)4 4 !4DLH=( Lq@L a21L2 H5& AH(1[]A\A]A^A_fD1E$E$$$^ff.H2HtH8H2H?HH H5zHH2H0ff.H 2HH9tHy2H2H9H]2HtHHH?2H8H AH5HH 2H0ff.=4DHH5& ff.fv4L1 H5?% DHH2D G4L1Aff.@H2D 4LEt6A"1D 4L1 H5$ AfL11 1H5$ Aff.4D=22DUSHHHt}H+HC@C|C,HC0HC8HCHǃHǃǃHǃHH[]DL921AL0 <H5# AHH[]H1L 211LToBH5T# A|ff.ATUSt[]A\IH5v$ HHtL2H1MS1L/ H5" AXZ[]A\ff.fAWAVAUATUSH(Ht$HT$DL$HIHD7HEHMID$HD$HE1D$1)fDM97G4AŅEHIELHAHH5L2M1L  sH5{ AfLH2IL 1E1H55 DL2I1L rH5 Akf.ML( f.HD28L#=#2H H HDHL 2PHPLH5v 1RgAH ML H=L#81H5+ L 2PHPL1AY^ff.fAVEAUIATIUHSHtEMHHLHxiuHHHtH[]A\A]A^HHHuL 21Lk' H5h AH[]A\A]A^1H[]A\A]A^fAWAVAUATUSHHt$HL$dH%(H$1HHID'HEIHD$Ht$@DE1Ht$ Ht$2H5 AWLL$(L% AY^D$ HL2L& AWLL$(H5b AXZLt$zD$ 8L 2LR% 1H5  AD$ DAUATUSHHEu+HIIE1MHHLHxuucHHHtHH[]A\A]DL 21L{% H5 AHH[]A\A]fHxH1ff.UH/SHHHHtHHHPH[] fHHsHH{[]HGPH0USHdH%(H$1H3H⹀HAH5X HHt!H$dH3 %(Hu9HĘ[]ÐI1L2Ls" H58 Aff.fUSHdH%(H$1HH⹀HAH5W HHt!H$dH3 %(Hu9HĘ[]ÐI1L2L# H5 A-ff.fHGPHÐUSHdH%(H$1HH⹁HAH5: )HHt!H$dH3 %(Hu9HĘ[]ÐI1LZ2L# H5 Amff.fUSHdH%(H$1HH⹁HAH5 iHHt!H$dH3 %(Hu9HĘ[]ÐI1L2L" H5 Aff.fAUIATUSHHdH%(H$1a/HAHt\Iٹ LP L!211H5 AH$dH3 %(HĘ[]A\A]HH;u1L 211L! H5" A@DH5HŅEt|HHEHHAHH5btIH=2AL U(L! LH UH5 SLEH1AXZI}XHIEXHtiADž@IٹL L 21ɺ1L\H5  AoDIٹ.1Lb2L H5 A9Iٹ!Ld RfAVAUATIUSHHdH%(H$1HAHHǃDH5[ LHǃELHEHLAHH5 2thL5a2AH L TLEȹ1OMUL ATH5 AHZYHHfLHHt_H$dH3 %(HĐ[]A\A]A^fDL 21ɺCLZH5 1AfDMX1Lr2LC H5 ApLI2M11L HH5 A6DIL 1RH5| Afw0G8ff.w4w0W4O8ff.fw<w@wDLJff.SHHHHLǛHt2H{tHS HB HC [HC HC[ÐL 2LRX1ɺH5U A1[UHSH( !4dH%(HD$1HD$L4HHT$HsÅAHHN21It$L4 H5 XZH|$H8}HȎ H xHDHIPHB LPH5F 1RH|$01H HL$dH3 %(H([]H21L H5 H|$xjH|$뙐t$ 4t$ 4fDL 21ɺ1LqVH5{ AEDcHH-, 8H UHSH( !4dH%(HD$1HD$4~|HT$HÅHH[21It$H5 L XZHHt$$y8_H|$AHL$dH3 %(H([]@t$ F4}t$ 348fDL 21ɺ1LUH5 AHh}IH H> HDHLPH H5 P1RH|$01H p*VfDH=4Ht HH4HH}4@AWAVIAUATUSHH8dH%(HD$(1=2HD$t AH-2;uO1E1L! H5 UHL$(dH3 %(DH8[]A\A]A^A_@HAŅ=HT$1cHD$HH5~ IٺAPL A1UY^Dp^CHm8I1PH[ LƈPH5 1XZAAA1H ^2H H= 4覽11H=41,AǃHl$H|HH 1DHIH-2Lf PH5V AUATAA1UH DR@%H]8zL C41LPH- PH5 1AYAZLe80;IٿH H HDHLߥPH H5 P1RAAE1H DLYQ1ɺ1H5Z E1U_f1E1L 2L H5 A%H-|28LeQL1PHL 4PH5 1A_AXf.H-$28H]=4H Hԇ HDHL 4PH"E1PLH5R 1RH fHD$PD$PHjjPAQEAȉщH1\H8HE1E1Q1R1jjWj+H8fDHHE11RE11VHjjPjH8ff.t7HE1ɉjHjAPE1PHXPjH8@f.H2H54)fHu2@Ht?u[2DHI21fH52@SHtfHNHv8I1L2L H5 A1[HHPH=2[ÐL ɾ211ɺL)NH53 A1[fDHe2@AWAVAUATUSL$HH $L9uHHt$IH5G:H=| dH%(H$P1HcIH$pH$0HD$HD$RPHxzPH{ PMLǘNH5 1AH :fDc8Hڴ2HD$L(褶A>MH 8Hz{ HDHLRPHH5 P1R7AH Hk2L\$HD$L(ٸ82A>MH ƷH{ HDHLPHH5 P1R>AL\$8H ѵM1ɺ9PH LxPH5L 1AAZA[ H2H.8臵A>tSWPHxPH`z PML<NH5 1H VPHxPHڶ3QPHxPHĶff.AWAVAUATUSHH $HAHIIκdH%(H$1HىAL-۲2u$L@B1ɺj1H5A AU$H11IAWLo nH5 ATUAUAFH H$dH3%(uH[]A\A]A^A_職A90tÐA9PuIHLLHUSHH $HdH%(H$1=͑2u+1H$dH3 %(HĨ[]H$AA1H 2H HիxiHH޿8tHV2H(.&I1PHL\vPH5 1X1ZBL 21ɺ 1L H5{ ADHff.AWAVAUATUSHH $HH $HdH%(H$ 1A|$t$H=Ht$D$u$L O2L?1ɺ~H5 ADL$AEt2H$ dH3%(DH []A\A]A^A_fDADH$HAŅtH$1H 2H H HԯIHHD$ L5e HD$L-ıL=Y2fLȸHL@LLtչLLt1ILHN HSSHT$H޿Yq\8qHʮ2L(袰1IٺPPHH5% PLs1AYE1^3L 21ɺ61Ly H5 E1A@fE1Lu+HF2H農8VI1PHLEsPH5 1XZfD{E18H2H(辯I1PHLr<PH59 1_AX@L 21ɺF1L H5 E1Af.A萲UHSHiHtLHHtHHqt H5~u1HvH[]fDH`@L 2111LT<H5T AH[]ATIUH SHtkHHt,LHH1vH߅@vu[]A\L W2L H5 AL 12111L;H5 A[]A\fSd2[ff.HC=]4u 52u1H t a2tދS21ff.ATUS1H dH%(HD$1D$f\$u%HL$dH3 %( H []A\ÐIFtHt$ ŅE$|$ Et'11 葭qA$|$ 蟹ŅHAL%2D$ H5 LN P1A$Y^Hl$fD8|$ H述xۋt$ 耺fL 921ɺ 1L9H5 ADHL2A1S L H5c A_AXߋt$ |@+jI,$薫AٹL P H5 1SXZߋt$ 1豹,@Hq2H(8BLv PH5 1SDL$AY1AZZf.H2=Lj2Lt(Ll 1L H5o AfDL] 1N H5G Aff.^2Du 1fHu 1H@HfDAWAVAUATUSHH $HL$ IHH$AEEHdH%(H$1K$u\L21ɺ1L]7H5g AD $H$dH3 %(DH[]A\A]A^A_fDDHAHH H ſHH HT$ D$8%=`AH9l$HsHH62H$`He1D1HL$`HAHl$豪yx8Dů11t$ DHm5IH$Lw 1BH5 AfIٹL Lu2H5 1AE1@$HC2uH$IH$I1L .H5 1AfH$H(ԧIٹL P5H5Y 1ATD襮X1Z1E1fM)L H$H(8]$IٿH H/l HDHLPH H5 P1R>E1H KPAUATUSHH $HdH%(H$1H$IAHHuWL Ф21ɺML04H5: 1AH$dH3 %(HĨ[]A\A]HHKxDHX2t!IL2 11RH5 Hx7LIZ1L H5~ AFDkL8tMLY 11۹VH5@ AfAWAVAUATUSHH $HH $HHdH%(H$8!1H$0HIHHA蘻u\L M21ɺi1L2H5 AE1H$8!dH3 %(DHH![]A\A]A^A_L$0LL%tL|$LL謦A…u]D$(%=DT$ =`MxL L2H5 1ADT$ @DL5Q2LHf6MH1IATL H5 AXZADXLH޿y W8tHLǡ2I1ATL 1H5, AAY1AZHuAbDL52HI1ATL 1H5 A_AXLD$ DT$ DT$ 譥8ML ~胥M8HI1AUH5W L AYE1^fH$LDT$ DT$ u$%H2DT$ H8Q$0MH H#g HDHLPHH5 P1RpDT$,H BfAWL=2AVAUATUSHHH2dH%(HD$81L#L9<DkLHE@H= DCSHDS$Dk Hk)A(Ds4AC8GH`2H$LH1IAVL H5 ARDT$$AUAH = 2tEDT$ Z}PL ;L$H5e 1Af.HLťI$M9t$DkLIHEH= -HD$8dH3%( HH[]A\A]A^A_DHF@H{@HfHDK0DC,HK(RDDA[]Zf.DHL$DHD$)D$H 2D$H $LA9AVI`PL# H5E 1AAYAZ1EEH }2H H=>4ٗANLl$ 1HGL谗D$ 11H=4/Hcl$ LljD$ H蠥DT$ H9+D誙2H$H(v8ϞLb1PH L 41PH5F 1_AXfH舵AŅD1b<DH$L(8AHI1PH LoaPH5 1AXZ_L !2L+1ɺ[H5 A/L$L]+11@H5^ AL f.H$L0$8}}IH5Zb H HEHL&PHu H5 P1RCAH L3 &CfH$L(褟81H5 L 4P6H0PL`1AY^H$H([8贜=}4H5a HFHEHPHL N4PLM~H5 1R,DT$,H e袟fSHHdH%(HD$1ou+HT$dH3%(uH[f.Ht$HS9L 2L'1ɺh H5 AE,13@%fA$DžHL$HdH3 %(HX[]A\A]A^A_fD諛H$28L;EL P AVH5} 1A_E $o AX1L HH5N AQXZ&DL 2L&1ɺj H5 AH- HAWAUASARAQE $t$8t$Ht$Xt$ht$xAPLY WVH5 QR PSU$P1H$ӸHĠH- |@H- l@H- \@H- L@H- <@H- ,@H- @H- @H-@@H-K@H- @H- @H- @H-} @H-u @H-s @H-n |@H- l@cHܔ28L;貖EL P AVfDH-LX $ϙff.@USHdH%(HD$1u"HT$dH3%(H[]ÉitHt$ɪÅu+L ,21ɺ 1L#H5 At$͢ÅuL2H1AU L@ H5J AXZRf.SHdH%(HD$1Ht$D$nHT$dH3%(uH[葘UHSHdH%(HD$1Ht$D$ÅtD$u+EHT$dH3%(uH[]fDEDU1SHHHt(HkH{HCHCHHt HfDHH[]ff.ATHEHUHSHHt7H@ Ht.8thLa2I11L H5 AHt0L32H1ISL 1H5 AXZH[]A\fH@Eu8u HtHUHHHSHHHtH@ Htt@HL2I1SLC 1H5. AXZHH[]fDH@H[]ff.fSHHHHD$ HtH@ Ht8tGL02fI1ZD$ L H5 AD$ H[D@H[DAWAVAUATUHSHL LoLM9LAD#A#twf.IHP L9u0DA uE(HH] L9}HIP uH]L9thIH] D#A#uL9ZHC@D HEtA tHHE I9usIHPfDLmE H[]A\A]A^A_fDA?t޺ LsoE;Wހ[yH b HcH>DEHL9tH DHu.u}uH] H[]A\A]A^A_E='^~t,E L9tHt1DP u2HL9t)Ht!#{@!փ@=@@uDž]EQ"uHSEL9C<"u/f.I9 BHڄw<"oHZ<\uI9zHBHHf]~%{}EH[EH}H]HCEL9S'ufD'HL9uHEHE HE HEHE L9YHMLfHXHDHڄt HZwHofAUATUSHH $HIHH$@H$HL$PL$Xt@)$`)$p)$)$)$)$)$)$dH%(H$(1Ld$H\$ IMHH$H$HD$H$0D$D$ 0HD$qL =H4$I}HHD1ǴÅuaL 21L H5 AH<$oH$(dH3 %(H[]A\A]H<$2H$HLHHD$H$0D$D$ 0HD$H3L L 211H5M AJԏ@UHATSHH DdH%(HE1AtjEAAA}LV2L 1QH5 AHMdH3 %(He[A\]ÐfZFH5 6ÅuLY1ɺA 15H5 ADL I21ɺC1LH5 A]DATIUSHH)Hs躭HHt"HLHDH[]A\L م21L H5[ AH[]A\ff.@AWAVIAUIATUSHHL$HLfLH MD$Hu <HEHIHH{LeS(HCHH+L RLHL211H5 AXZH[]A\@HS HsEH{0HEH{aS(HCHH+LW RLHE H{11IFHEA$tj"H{@HH50CHHE[PSHu$L 2Ln 1ɺH5 AsS(HCHH+L RLH@EMM4$#LxHLrHHHH%H)HHH9tHH$H9ut H)HLHT$H"I4$HzIHUuHU H!%tDHrHD։"Hf 1LLHH5JzMt$ MJ1LLHH5Ά[sI~EuA>t1LH5h H#LH0XA>~fDHL HCHtH@Ht HSLLMd$Mt EAf.HMdH3 %(DAHe[A\A]A^A_]"LvH!LvHL-vED1H5THBHL$EEI|$1HڍH>H;D1LH5 HEL1ɺ^D1LH5 HAttLHMvMtXA>tR1LH5 H>uEL`1ɺLq2H5w 1ADMh1LH5  HEL 1ɺfDLHDL iq21ɺ1LH5 AE1f1LH5 HllEL1ɺELv1ɺLp2H5 ADM1MEL?1ɺqljEL,1ɺx봉EL1ɺ롉EL1ɺ뎉EL1ɺ|xEL1ɺ~bEL1ɺLEL1ɺ6EL1ɺ6EL1ɺ 4u@AVAAUIH=o ATIUHSLH0dH%(HD$(1蔕Ld$H$Hl$H\$Ht|LH1DH<$Åt2HL$(dH3 %(unH0[]A\A]A^fL To211LH5 AL )o21ɺ1LH5 A3tUHHHSHHtHP tVt9HLn2I1S>L| 1H5O AXZH[]HzH[]1HzH[]AT1IUSHH@HdH%(HD$81HHT$HH{Ht@It$ H{HHE HtVHD$HHL$8dH3 %(uaH@[]A\L m211ɺLIH5n A1fDL m2L"1ɺH5@ A1rAVAUATUSHdH%(HD$1H$HIHIIH-%fDH<$BmH[HtiH 1LHLixzHsH<$LHuHuL l2LX1ɺH5v AH<$l1 DHL$dH3 %(ulH[]A\A]A^fDL l211ɺLH5 A1fDL al2L1ɺH5 Amjqf.U(H=WSHHt0 HHHHtPHXHH[]f.L k211L iH5T AHH[]L k2L 1nH5# AHDHwHGHӑHtHGHGf.1ff.fHHw@HHHwE1H7HHHwAH@UHSH~HHt&HjHHHTt:HH[]L yj211ɺLH5 AHH[]H1L ?j211LH5 Aff.I1Hf.I1H1ff.fHIо1f.HI11ff.fHE1HH5 HAHH5@HHfH1dH%(HD$81H)D$H|$1)$)D$ rHL$8dH3 %(uHH(nHHcHH5kHÐHHH5Of.HH52=ff.fHH5{ff.Ht7t1t@HHNH1ff.fHE1HH5gHAHH5D@HHcHH5HÐHHH5f.HH5rff.fHH5P[ff.SfHHHH@dH %(HL$81H)D$H|$1)$)D$ mHt8HP 1Ht uHtHRH\$8dH3%(u H@[Ð1kSfHHHH@dH %(HL$81H)D$H|$1)$)D$ Ht8HP 1Ht uHtHRHH\$8dH3%(u H@[1gkSfHHHH@dH %(HL$81H)D$H|$1)$)D$ MHt@HP 1Ht:tH\$8dH3%(u$H@[fHtHRHD1jff.@SfHHHH@dH %(HL$81H)D$H|$1)$)D$ Ht0HP Ht'HtHHL$8dH3 %(uH@[@1?jff.@SfHHHH@dH %(HL$81H)D$H|$1)$)D$ Ht8H1Hz tH\$8dH3%(u H@[fDHtHՐ1iHHf1HdH%(HD$81H)D$H|$1)$)D$ HHL$8dH3 %(uHH?iff.@HWH[HtHAT{IUSH&a}HLa[…!9]A\!fAUATUSHHH0IAvHHH3HtL認HEHC(Hs E(HtLHE HtUHsHtLwHEHt6EtHsHtDLUHEHtHH[]A\A]fDL b21ɺ`1L!H5F 1AfDL b211L MH5 AHH[]A\A]L Qb2L 1RH5 ANf.L b2Lb 1WH5 AfHSATI0UHSHԌHHt,H}LHHtPHCHC H[]A\L a21L+ oH5 AH[]A\L Qa2L 1۹sH5 Aff.fH ff.HtwHtG1ff.fHGATUHSIHt>1Ht/HHHCH9uH3LH=dHH9uL[]A\L c`21ɺ1LH5 AfHWHt?H9u*@H9tHHBHufDHFHBHBHG1ÐAVAUATIUHSH:Ht}HHLID^tT1HvLL_LLHI^t-LLH^1ɅuHJ4+LL)]1Ʌ[]A\A]A^@[]A\A]A^AWMAVIAUIATIUHSH(H?DL$ dH%(HD$1HH}LHIHCHH}L0HCHfAoD$ H+H{HLl$CfAoNK(fAoV fCpL{xS8H{XHAFAVLH}HH H HH%H кHD$tgA<$HL$dH3 %(HH([]A\A]A^A_fDL ]211LA H5k A.L ]2L8 H5D AH}H1[jfDH}HLM4L h]2L H5 AH}LaH}H1YbfAWIAVMAUAATAUSHLD$|HHHuKL \211L H5F AH%H[]A\A]A^A_DHŒtEH0ŅuZL1ɺL U\2H5 1AfL 9\21ɺ1LH5 1AkLH&ŅMH芊H|$H=L} IHudL [2H5I 1AH,L [2L 1ɺH5 AH|$Pt8H`H|$H装HT$PHHuL \ffDLy1ɺff.fAW1AAVI1AUEL ATAUHSHHZ2DL$ IRVH59 ZYyHDHH衐uMLvZ2I1E1L H5 AHF#HD[]A\A]A^A_@DHetH)+u$LZ2L1ɺ H5 AMtALHݿAątD$ uvH&.1AątDAfDH\IHY2I1E1Lu H5 DH*ff.AVAAUAATIUSCxHHH-uAL Y211LR H5t AH![]A\A]A^DHtLHn(Ņu`L X21ɺ1LH5 AL yX2111LH5 A[]A\A]A^DDH,ŅtKfM1L X2L H5 Aff.@ATAU SvHHH׍tSDHtDH(u$L W2L2 1ɺH5 AH+txH[]A\L YW2L/ 1H5 AH1- H[]A\DL W211ɺLyH5 AH[]A\fL V2LR1ɺH5g Af.AWAVEL AUAATAUHSHHV2D$X $1LL$ID$1R2VH5 ZYuHHHH艄ADžuJI;1L,V2L H5 AHHD[]A\A]A^A_@DH uqLU2I1E1L @H5P AHU2I1E1Le 5H5 oDDH譋tHq&u$LVU2L1ɺEH5 A4$DH["u$L U2Lq 1ɺHH5 AT$Ht$PHADžu2LT21ɺK1LCH5_ AH)ADžtQD$`uYHt$HDADžsL1ɺTLtT2H5 1AHfDL1ɺNr렐HL5T2A1hL vH5 A1H@SHOHHxWDK4DC0H HHDHH1NxH[HfDL S211ɺL H5% AHC[@AVAUIATUSHH0w40dH%(HD$(1HD$HD$ aHHL$HT$1HLL$ LD$HLd$MI H=LtoHR2L(HHH5` ATILa 1E1AY^HHT$(dH3%(DH0[]A\A]A^ÐH|$ LkAąu\L eR21ɺ1LH5 A@L 9R21ɺ1LH5 E1AmfH R2Lt$ HL AVMMPL 1H5k AXAZHQ2L% L(VDUHSHHHH84yHtHXHHH[]@L OQ2L_ H5 AH1[]HGHHWHH9u HH9tH;pu@UHHSHHTtH{XHDH[]DAUAATIUHSHHH8{HHt5DhHx(L`HHHH[]A\A]L iP21Lk  H5 AHH[]A\A]fATIUHSH?H &{Ht)L`H{(HHhmC []A\|L O2L H5\ A[1]A\f.AWIAVMAUEATAUSHHnHHH葅u]HA[ATL LLO21H5 AXZH;E1.HHD[]A\A]A^A_DH;DEtH;EuyT#HAgATL LN2H5W A^_|D1ɺWE1L N2LH5 A]@K t_H;vHt$@H; tgHD$@A@9tkHAtPL2 DHAaATL fHAmATL HD$@@A9tHEyPL RH;=|H;I}H;IHT$HHSf.HWHHOHH9UHSHHH;rt]HH;XtHH9uH[]H;Zt2HH9uH{XHCXH9tH9ou %DH;otH?H9uHfDH[]մ@UHSHHHuHH[]FfDHL2HHL SIH5 1H1[]ÐATIUSHHA$u@9uTH[]A\@L!L2HTHe 1LLLw 1dH5 AH[]A\@HHHL1H LK2L HDLLkPH5. 1AXHZ[]A\@L K21ɺ_1LH5 A)ff.fAWIAVIAUATUSHHHw40dH%(H$81HD$ HD$(&HHL$HT$1HLL$(LD$ HLl$ MH={LL%J2M$1ɺH5* 1LL$(L- AHt$(1HT$0hH`A?H$0E1PAA>@HELݲ 1RH5 jP1A$H EH$0H8IH$0I@L%I2L- M$HLT$HAUI1LT$L H5 AXHZoL1ɺ1H5 1A$H$8dH3%(HH[]A\A]A^A_fHELɱ 1RH5 jP1A$H Et6A?HV H @ s4HDȋ{01ŅEA>H= H ) s4HDȋ{01JŅL1ɺ1H5 A$mH$0E1PAfDL%1H21ɺ1LH5 A$@E1Li1ɺH5y A$HfDL91ɺ1H5L A$LfDUSHHN4V0 uBŋC4HLnG2LKLf PC0H5 P1sAH H[]AWAVAULo(ATUSH8Lw(H4$dH%(HD$(1M9ELIMIH˺Hl$IWHH'/Hc;L1HHH)H<$@6Mm1M9AD$IuvHT$ T$ HIHc;LH IMMIH HEH)1H<$y@yL1ɺL F2H5 1AAEHc;L1HXH)H<$%@4L61ɺDAH\$(dH3%(DubH8[]A\A]A^A_É$L1ɺLxE2H5 AD $L1ɺ9$L1ɺhJHw1HAH AUUUUUUUUDAA33333333DAADAAAȉсUUUUUUUUʉ33333333ʉʉAAAADPHVH9t H*@ff.@AWE1AVAUATUSH8Dg dH%(HD$(1D$$D'I1GtDHIEEDChEmG! HD<NHA?DK8ANjCD$ 0HQC2LLH$D$ nH ttD$ HH Hg H1EHѼ S=KL$D$$1ɺq L :L1H5c AaHD$HEL|$AL=L$L L v H5 ALj HcD$$LH)I|v7|$ u01H <F D$$LD$$HH)I|DSttKh t4HI D'<K D$$LD$$HH)I|EE1fDAE9DHLsLI|DH)H< 1;%D$$D$$Ht*1HP x;D$$LHc|$$H)LKht*1H4 G;D$$LHc|$$H)L|$ u6v11H ; D$$LHc|$$H)Lt*1Hߺ :SD$$LHc|$$H)Lt4H DE1D:D$$LHc|$$H)L1DHe:HL$$LLHD$$ADžADHL$(dH3 %(D)H8[]A\A]A^A_f.fD DDDDChEkfDEH?2H5 1LK IH$1ACHc|$$LDK8D$ D$ H)L0D$ f.L1ɺ H$H5* 1AHy>2LLH$L= A9LI|H)HHs1L4yD$$LD$$HH)I|L1ɺ D1H b4DD$$LD$$HH)I| !1H 4vL1ɺ D1Ha 3 L1ɺ L1ɺ H$L11 H5ͱ NL1ɺ yL1ɺ f1H" J3D$$LHc|$$H)LLB1ɺ $L/1ɺ 1H 2D$$LHc|$$H)LL1ɺ L1ɺ L1ɺ L1ɺ L1ɺ L1ɺ pL{1ɺ ]Lh1ɺ JLU1ɺ 7LB1ɺ $L/1ɺ L1ɺ H|$HL @1>,fDXAV(s4{0HL$H-12A~Lew-68$L 1ɺH1H5 AL1ɺ1H5 E1UINMF @1H|$Hz +QANH|$@1HO m+0ANH|$@1H L+ANEF@1H|$H '+H|$H. @1 +DA~tYM6M9}ǃfDH-02L -1(H5 Uf.HHADžL|$IN I9tH%02HHL$H(HL$Lě IH5 1QAWE1XZ$H /2HL!H)HUAWIs1Lʙ H5. E1A_AXǃ Ht/2HH(iHLA AWIlH5֧ 1AAYAZsH)/2L GH-2IqL- HE1HLJ UIH5m AV1AUAH H.2L H-12L5| L-#2H.2H-L L5 2L EnHtHL AUI81H5 AYEN1^@L H5 U1ENL< BH5 ULt 11CH5w URH- L5P1L5 H-n L5 L-'1H-1L5f |L1ɺ2HGHGxDHt5HB`H`H9uHXHH9tH;xu1HGHHHHH9uf.HH9tH;Pu1ff.@UHSHHHHH9t@HHx,HEHH9tGHHHpHHH[]?HtH[]1HtAWAVAUEATIHUSHHxHH4$L|$0DD$ LdH%(HD$h1HD$HD$H HD$ H%HD$(H H кHD$0ԍIHEtKH<$LtdH|$HttH\$hdH3%(LXHx[]A\A]A^A_fDpltD$ AFlLH<$fAFpcuL1ɺL +2H5 1E1AnfHl.DHD$)D$0)D$@)D$PHD$ HD$(K#Dd$Hl$LHT$(Ht$ E1LDL$ HLL1ɺIHaDhlH<$H;AL$}HD$Htstml$ E1DAALHTHHHH  IHHD$AD9(wMRDI$LHpuL )2L1ɺH53 AHD$HL$ E1ɉH|$PDAWLD$8_AXL Z)2Lø1ɺH5ء AL ))21ɺ1LH5 A0.HdH%(HD$1 HGt0ЉHH HH%H HH кH$ފHL$dH3 %(uH-@AWAVAUIATUSHdH%(H$1Ht>Iu8M}H$dH3 %(LHĸ[]A\A]A^A_HHpIHt0ML| 1ɺXL'2H5| 1AD3iHHD$'H$H-L(I1IT$HT$MH,ÍPT$HH|$H,H\$ LM)H-I}HBD$ 衊IHt9L2'2H1IUhL$ 1H5 MAXZH$Ht$Lo%H,$I}LH4IHt,IL 1ɺtfDD$ML 1ɺx+DAWHAVEAUIATIHULSHHI|HH;LIHtXIGPHHaAąL1ɺb L &2H5 1AHD[]A\A]A^A_fDM\ LT L%2H5I E1AfL %21ɺY 1LH5 E1ADH;LHt`IGHHHAątj1EAGI$LHpt*D$MA$D$A$f.LY1ɺL 2H5g 1AD-L%2L H54 A$L1ɺ1H5 E1A$8HD$PHL$hADH|$HPAVL$ZYLL$X7L%(2L H5 A$t@LL$XL 1EH5| A$LH|$HH2(LL$X1Lx ?H5/ A$H|$HHuAW4Eo0LL$XL LH5 A$L1ɺQ1H5ғ A$L.H|$HH$$lLm1ɺQ1H5 A$LH|$HHLl$(H\$0l$8Ld$Ӄ$I9?Ld$l$81ɺbLl$(H\$0LH5 A$Hjt$(D$(P8H(HE1E1HwHHDHE1DHwщHH@AWIAVIAUATUSHH|$dH%(H$1HD$8D$$HD$8HD$fHt$H|$1HH#HIHHIHHH LLHHMH2L RD$|H5 P$P1L1ɺ'H5ω 1H D$fL1ɺL 2H5 1AeDLY1ɺL 2LB1ɺH5W A'L1ɺL 2H5' AD$@H$dH3 %(D$H[]A\A]A^A_LM.IoXIXL9H\$8H$Ld$ IHl$Ll$0Ll$Lt$(HHHt\I|$tIHHpxjE1E1L虲A[Z^D$Et$vM$$M9t@I|$HvL o2L؞1ɺH5 AM$$M9uH\$8Ld$ Lt$(Ll$0HtHT$H4$H:HDCpLT$lt$hDHT$TtD$Xt ?-HHt9HHЅu$L 2L 1ɺOH5 A1H9D$HT$HH4$HiL1ɺXfDD$lML} PD$pPL2H5 1AY^D$cD$lML} DPD$pPH 2Ld$ 11Lt$(Ll$0LH56 DL$ED$lML} 5H5 PD$pP1_AXD$HI 2Ld$ 1LLt$(Ll$0H5 Ld$ Ll$0MHLt$0PABH 2L| H5u PABP1LL$ H )t$l|$hZH t$l|$h[DH 1DAWAVAUATUH-̛SHHhHt$Lt$HHT$dH%(HD$X1HD$H@1HLIHLHHT$Ht$Ht1LtHT$Ht$LXuD$$1ɺL 2LH52 AHL$XdH3 %(D$$ Hh[]A\A]A^A_DI1ɺL Z 2H5 A#HD$PD$$1HD$HH$D$ 1HLIHWA9ohuLHHT$Ht$HtLRHD$H\IHD$PL%HK@H<$1H IHM9tLHMHLuID$ f.L) 2L1ɺH5 ALL\$0LL$(ULL$(ALEL\$0bIILJIGAGA O$HAW4Aw0MOEAIPAGpPIHP蹲H t$$AA3AOD$$AW HT$Ht$LD$$L 2Lr1ɺGH5 AL 2LB1ɺH5W AD$ |pML2IHEop1L HD$@AG4H5 ATPAG0P1LL$8L\$HAH N'L\$(HHt$HL\$0HD$(I6LL$(L\$0MMϹLL$L x H5g L$ALL$AE4HAL x ,PAE0H5 P1LL$8AH D$$La2Lʖ1ɺH5 ALLL\$0LL$(8LL$(L\$0MMLt1ɺH5 L$ALL$fL2LM#農LU 9IH56 1AD$$l@LL$1L$Lv MH5~ AL$LJ2L1ɺH5~ L\$(AML\$(LL\$0LL$(LL$(L\$0u1LL$0Ls1ɺL\$(H5k~ ALL$0L\$(Ht$8LAL\$0LL$(HkLL$(L\$0LL$ML$ MMf.AWAVAUATUSHXH|$Ht$8HT$@dH%(H$H1H$HDŽ$D$PD$hD$THD$(Ht$H|$(1_IHsHD$vAAm0I}HT$@Ht$8譤t1LO%AmcEEtHD$ǀEM$EuEELBEE2AEA ]$"HAU4Au0MMEAI}PAEpPIEHPH l$ht%AtE]EtEU ED@EEDD$PD$PA]01L*HT$@Ht$8LŅL1ɺ L 12H5{ 1AL=2MM11L UH5{ A1"HH{IuH1MMMLls ]H5;{ AHL1ɺ 1H5{ AfH$HdH3%(b*HX[]A\A]A^A_DL=92LI.L\ 1ɺ IH5z 1ӿ#!HD$HAu0H|$8H\$Au4H8AtH#H|$uL1ɺ* H5z AMIHD$0I9O'1Ll$HILMIƐHD$HX4@0D$$\$HIH?AODŽ$ HŁ HcH>LI Llr IH5Xy 1H|$L 1ɺ 1H53y AH|$.D$TL1ɺ H5x ApDD$PE"|$TiHD$pujHD$Ht[H|$jlH|$1VH|$Wu*HHtH1ЉŅ"fVfDIuH3A]EE H MMMLzp nMMMLo 1XH5w AfH|$oku&L 11ɺ 1LtH5w AH|$19L$T1ffDMMML{ bD$TH$IH M1ɺ- LۍH5v ALʍ1ɺ H5v 1ALGL1ɺ 1H5v AL1ɺ/ 1H5v AH|$3f.H$I@H)IHHqL$H$Ƅ$ LT$XLT$XE1MHHA{ HLfAOwH  MHHHr~ HDATL?p PH5u AwAUD$@P1DL$TAAGHH0HLIWH|$ML3{ LMoM?L;|$0QLl$Ll$HMH|$uLp 1ɺ2 H5t AAH|$ADžH|$3wfDAL$I8LLT$XD$`AD$lA|D$xAD$pAxD$|5LT$XX M1ɺ L"H5>t AL1ɺ EDH$IwPHܳIPHL$L贳IPAHLAE`MXуууууу Hك@AdHAhRHjm P1H Å$IPt/HcHHGy 1L$H)LLÅAAl|S @t*HcHI1H)I<HYy >6H|$,L=1ɺ H5Mr AbfH$IwPHM1ɺb LH5 r AL݈1ɺ AO EG81HHv L$H$IwPHHL$XwHL$XMLp1ɺ fH5|q AL@IIH53aIHIDH#ML aM IP1WLRHv VHH %Lʇ1ɺ H5p 1ALJI1Lql  HH5p AM 1LKk H5p AH$I@H!yM1ɺ$ LH5/p AL1ɺ 6fDH$H$DŽ$H$DŽ$DŽ$DŽ$7 AWt $$Awl$=ۃ=D$` Ix2$$$=D$XЉUUUU%UUUUȉ3333%3333ȉ%ȉ% t$XIw`HKL$L$lLwL$lHc$L mHMGxI<H=s H)1-$HHcH)$LI`t;L$1HyL$HHc$H)LAOh1HH|$HHcAGl$H)Lt D$XmAGtD\$`Et01H U6$HHc$H)LAOp1Hnr !HLL$H$|(LHc$HHr H)I<1$L݃1ɺJ 1H5l AH$IwPHHD$X藬?ML1ɺ{ )fHLL¯2AOwH MHH% ATLf H5Dl SAwAUD$@P1DL$TAHH0HuL1ɺsH5k AH MML1ɺ :f.1H$HLLثA<$MJAOM 1Ld H5Vk AfDIL$H2p LLT$XH41LT$XfAAHymAAD$XAAMD$`AD$lAD$xAt!H3tH3HzHEAL_k EH`k IEHMA HD$xD$`IPD$pP$P$PSWLVHQALASRHc $PAHP1Hp LĀ1ɺG 1H5i AHc$H1H%H)LaLr1ɺ fDL$ILLT$X4LT$XA@ЃHEHEHEHEу у@y A(AAPEI0tAIMAH5>PDхH /LHDH1RH?n \AXAYÅA@  5  @^AAjI0HHHcHM81H)I<HL~1ɺ 1H5g Af.H$I8HHD$X脧M1ɺ( Lv~H5g A^L$IwHLLD$`7LD$`JA<AW@HHc$HRHL$hH*l DHPH)1LAYAZGL}1ɺ I@H$LT$XH账LT$XEAH=j H5j H j Hk EpELIDAIDA|ID˅AxIDӅHj IDHWVQRP$1$$ҋ$D$1҅L1҅H1҅L1EIH#k P1AhH@L|1ɺ 1H5e AfML|1ɺ f.M1ɺU LZ|H5ve ALI|1ɺ }DML.|1ɺ fM1ɺL |H5&e AL{1ɺv -DM1ɺ L{H5d AL{1ɺ DAwl1D$`JD$XtDH1LH+Lh IH5~d 1H|$xD$TL5{1ɺ H5Ed LML^ IAFH5d HD$PD$,PHl LL 1ALgXZ fDƄ$L$Iw`HL$L$lLgL$lL bT$XHc$HHHDh AH)I<L1 Lz1ɺ2 1H51c AAL MHHLy1ɺ DL$IwPLLT$`蟢LT$`M1ɺ, LyH5b AtDLILa[  IH5ub 1@M1ɺe L*yH5Fb A7M1ɺ LyH5b AMLx1ɺ} zf.HL$XIMHH L1Åi HHApHpH)I<1f1AGtHHcHoH)ƃI<14 AWtHHcH)I<$@Hf 1Å5IH)HHlHHDHcH)I<11H/oHAtHcAI<H)1xrAtD t0IcHDL$XH f H)I<1=DL$XAIH}HXHpLl$XEHS Ht-IcHLBH H)I<He 1AH[HuLl$XHT$@Ht$81L L==1Lv1ɺ H5_ AH|$D$TZLsv1ɺ H5_ AHc$L HcHAHe H)I<1D AtIuH4D$hMMMLW H5^ AHcHIHd H)I<1z A@-HcHAHKe H)I<1A AHcHIH,d H)I<1 A@HcHIHd H)I<1p A@Hc$HHb L$lH)I<1L$lIw`$$HL$L$lLa/fMLVt11+ H5i] A9HcHIHHc H)I<1 A@H|$Iu2Åt4AE$u,LI/iL"X 1ɺ; IH5\ 1H|$nHH;D$_ ADžM'H_ L HIH=WLW L PH5v\ 1t$0AAH 6ADžH|$譬^H|$7ADžH~fLr1ɺ 1H5[ A@Lr1ɺ` 1H5[ A@L J#@MIL#U 10 H5~[ AM1ɺ] L:rH5V[ AM1ɺ LrH5.[ A;HcHH]a H)I<1ÅLq1ɺ 1H5Z AHXtAHeMMMLR 1iH5Z AHOfDHcHApH` H)I<1OA[HcHAtHw` H)I<1WA#HcHAxHO` H)I<1~;ALyp1ɺ 1H5Y A@HcHIH_ H)I<1?A@HcHA|H_ H)I<1AKLo1ɺ7 1H5X A1H Z $HHc$H)LLxo1ɺ5 1H5X ALTo1ɺ0 1H5gX AwL0o1ɺD 1H5CX ASML o11H5X ALn1ɺ 1H5W AA(HcHH] H)I<1~ÅnLn1ɺ 1H5W AHcHH] H)I<15A@L7n1ɺ. 1H5JW AZHcHHK] H)I<1A@1HY4Lm1ɺ? 1H5V AHcA,HH\ H)I<1lÅjL{m1ɺ 1H5V ALI% LO IL$l$L TLm1ɺ 1H5,V A
  • 11ɺ 1LaH5J AB L111H5RE A^_fDILA .1LLLD${LD$HII<$LLD$̣LD$HI@HL|ŅuVL[1ɺL !1H5D 1AHj@L)A D$@I<$LDI8HHLŅu{L[1ɺxL 11ɺ1LZH5D 1A$MLK LU1H5C 1AI<$L蜢IGPH@HLTŅDHD$`A_tH|$XALJtIHD$hI HD$pI(HD$xI0$ApHD$PII$Ht$X1H8gIHH@HL@ MAL ~8IPAtH@ H@HL@ MAH0L€tAML|? ML? jL/Y1ɺ$9HAt Le1H5@ E1A뽐L I11ɺ1LWH5@ E1ADH}L脟HCPHt+HH@Aąu9LbW1ɺ:fDML > [HL$PAooQoa oq0(oA@8Hq8)$HHy@HEH8H0HD$PHp@HEH8H8f.AWEAVIH AUMATIUSHH"vHMt\H;LHFHPHHHAąulLV1ɺ)L 1H5+? 1A-@L 1LWF 1H5> AHD[]A\A]A^A_DH;L譝HEPHHHeAąu~LU1ɺ1eM$L\< L1H5y> E1AwfDL 11ɺ1L)UH5E> E1ACfAoEAXAoMhAoU xAo]0DǃM,L; CH1FL 1L; H5= A1HH1UL 1L; H5U= A1HAWAVAUATUSDHHT$AA vKHh L9 Lb111H5< AZYH[]A\A]A^A_@H IHMRsIHnI<$HzI8HHL/ŅmD$`I8HHH9trE1@L}IvNL1M1LC H5< AHEI8HL)AHEHmHH9uI<$L豚I@HqHLfŅLR1ɺfHhL8 xILB L1H5Q; 1AbL 11ɺ1LRH5; 1A.LQ1ɺL c1H5: 1ADI8HL$IPǀI@ǀ1HADŽ$A$HD$PI`IhD$XApAx/)}f.MLA HjD$(Pt$(H(AWIAVIAUATUHS HtHIHE0H8LL38 IHtAZIGL9SLT8 L 1H5g9 1E1A.DL)P1ɺL 1H579 1E1AHD[]A\A]A^A_DLy1A1E1L@ H58 AA E}AE(=A]LI$PA'DžofDL)7 M9AAE}EufAwGE}AE(wfDI9$`tL7 M}IE DD(kAƅuLN1ɺL L1H57 1AfDDjAƅLN1ɺDDjLaN1ɺ3DDjff.U SHHrHt|H[]L 1LM1ɺ!H56 AH1[]ff.S qHt[DL !1LM1ɺ/H56 A1[S qHt[DL ѽ1L:M1ɺ<H5O6 A1[AVIHAUAATUHSH?HHHHI趐ÅtHAL HlHL@D[]A\A]A^@LL1ɺQL 11H55 A[]A\A]A^IL111L0= LH5X5 A[]A\A]A^DhhÅ;LL1ɺTqL 11ɺW1LKH54 A&ff.fAUI ATUSHHoHH;LH苓IHt3HHHÅLHH[]A\A]DLٻ1M11۹L3 kH5H4 AH[]A\A]DL 1111LJfH54 AH[]A\A]L a111ɺpLJH53 AH[]A\A]DAUIATIUSHHdH%(H$1Ht>HuvH;I<$HHHHLHLÅWLmHI<$LHHdjÅZHuHD$%=`2ILf2 L7111H52 A-fL 111L1 H52 AH$dH3 %((HĨ[]A\A]fDL 11ɺ1L!IH5=2 AILrIIٹL9 )LH1ɺL K1H51 1A@DLH1ɺHT$(I<$E1E1LHHH  轌HH*L ڸ11ɺ1L:HH5V1 1A߽ff.@UHSHHkHtvP v>L w111L0 H50 AH[]f.HHsH;H1HgÅt:L 111ɺLiGH50 AH[]ÐL ٷ11ɺ1L9GH5U0 AbDHHff.fAWIHAVAUIATMUHSHHLD$fHH;LI趎IHtJHLL 11ɺ1LFH5/ AH[]A\A]A^A_M1Lڶ1Ld7 H5Z/ AfL 11ɺ1LFH55/ 1AfDIHŅtkAo$HD$AAoL$AAoT$ AAo\$0MAIǃfL 11ɺ1LiEH5. ADUHSHHdH%(H$1H!xmT$@u&H$dH3 %(HĨ[]D1Iٹ"LZ1L9 H5g9 A1H91H(豹8 ;IٿH H{ HDHLPH_H59 P1R1H BAUATUSHdH%(H$1?u/H$dH3 %(HĨ[]A\A]DIHHպuD$%=@tL-J1M11Lw8 .H5K8 AUL迸HHHu/H{/跷HHtg}t޾H艽yP8uHuL"C1ɺ=H57 AUH裳I]NDL+xHf.۷8I]ugHO1LB1ɺfH5H7 1xf.L7 12H57 AUI]軴}H WHy HDHIPH1LaPRPH56 1H H藲I]?fDLLA1ɺMDI]}H Hx HDHIPHLĕPR@^,ff.AUIATL%2UH-SH HHH(HHHH€tHƹLtH1蔸taHi1H8:Mz1PH@LhvPH5T5 1XZH[]A\A]ÐH߽3uH[]A\A]H11Hq8ʲ1MqPHH54 PLu1Y^ff.USHHΰH߉Ķt uH[]D H[]ff.@AVAAUIATUSH`dH%(HD$X1HD$AH$HD$1H)T8 te t`tH-1L4 1H53 U3uGHL$XdH3 %(}H`[]A\A]A^fDA~$]óH]8M1PHLFtPH523 1X1ZvDH1Hq8ʰHML3 P1H52 A]1A^'fD1wHl$ 2Lt A2H1IߵA$I!%tHDIT$LDII)L訶IHL911-߉1¸DNH-ǭ18Le蜯HML3 PH51 1A_AXLTLe8L1MPHPH5n1 PLrr1AY^f.諱8H-1ATM1AVL2 H51 UAYAZ\H-٬1Le谮HML1 PH50 1AA[A\H-18LefHML1 P8H-Z1Le1HML1 P记H-'18LeHML1 P^)fAU1ATUHSH8dH%(HD$(1踭ÉH1$HD$HD$Įx@)t&L ~11ɺ1L:H5/ A1f<$u˯L%D18M,$HIP1Lv1 H52/ AXZ覧t"Lk:1ɺ1H5 / A$f1HL$(dH3 %(u H8[]A\A]f.@1ffDATUSHPtEH1E1DH菪H9HBAD$H<@IHHHPuH[]A\fD1H[]A\fDAWIAVAULoPATUSHG(LwPAĉD$ AM9t_I^InH9tIEtHC@) t IN(@HI~8uAF0tH{ީHK9A}AHH9uM6M9uDt$ AEw(H[]A\A]A^A_H6H?鱮Mt+MHMQMt }@tw1@ /@u&~ f(\fTхf/1MI@1\fTf/fUHHSLH¸t1HtHCHH8ۭH[]@~ Hf(\f(fTf/&f/иw?#f/w1Af/w\fTf/Af/gpHH9t1MtI@H9fDH HH9r H;Nv1I;uHFI9Df/wBrf/w4A\fTf/.A\F1fTf/D^f/8\fTf/vff/Vf/\fTf/1MIPf/wf(\fTf/Vf/\1fTf/H HH9rH;Nj1M_IHH H9O1H;NÐ(f/V#ff/HH9t1I;1I;øfDHHpHHxfHHHB@8AVAUATD`USLr(1Li(IHPHx IDj(Hp `t1HHH9tn@tNH9[]A\A]A^f.苪t?@tOD[]A\A]A^f.H9[]A\A]A^@HCI9t*HV[]A\A]A^fD11랐SHwHHtH?{HCH{P HC@HK@H9tDPPHH9uK([ÐSHWH@H2HH JuH[fDATUSHHG(u []A\HoPAHq uHC@HK@H9t&P(uցD t P(HH9uH{PH9tHGHOH9t;HPHt':t"HpV(tV(f.HH9uH?H9uQL 11L* H5L A[1]A\ff.Ht#SH_H u H[ 1[@1DAWAVIAUATIULSLH(L~H$L$ dH%(HD$1HD$M/Mu_IM/MtLLܢH9uHHL)uHL$dH3 %(L&H([]A\A]A^A_A$H$HLPHDl$ ILL$D;1LIDH0A҉Ņ~D;Ll$xDH1A$L K LKDmHIF`HHK LDʃtDH< PL) 1H57K AD;XZuE1fMT$:H8 PH5J LO( 1AD;Y^A蓦ATIUHSHH>ˡ1LHHHu.uHHHADHuI$H9E[HD]A\USHHt,HjHHfHHtDZ uH[]HAWAVIAUAATUHHSHH]IHt:DEtDmtH蝠HLHIt(HH]Hu1MtM>H[]A\A]A^A_fMtK'IEH[]A\A]A^A_fAWAVAUATIUHSHLn8 uBL 1ù1L' zH5NI AH[]A\A]A^A_fDH5sHt1LHu?L 111L' H5H AHf.1H5H HotH5L HWtH+IHtID$(L51IT$DH M>Z EtBHDK1HwLPH5EH 1AIT$ID$(M>_Z AXHx(tIHx8tBHDK1ɺHJH5H PLE1AID$M>H YX Y^LyH1ɺAUD 1L H5G AID$LH@ XZAt*HHxt;0uf;0t H Hxu1H-fDAVAAUAATA0UHSH?HHH1EtoOdDcH}pIIAHA@ Ds,A0CCK(QHC HA H}@Dk(Au HH[]A\A]A^@HE`fHH[]A\A]A^@L 11L$ BH5cF AH[]A\A]A^MH31L%1L$ H5"F A$1L ,1ɺGH5F A$H}H14H[]A\A]A^AUAATUHSHL%W1uLg`HE@HM@H9uDHH99P,u9XuEH( u)U8D ru8PH(H[]A\A]@H[1ɺ%L1HL# H5+E ML1AH[]A\A]DEt/H[HA EH[]A\A]H[]A\A]ùH}H;L =1L*1ɺH5D A12fAWAVAUATUHSHH8LfPH4$L$$DD$ MIHE1fHH9HBAEH<@IHLHPuLkpI}t,@I}诚HH9HBI I}uMHCpE1H$L5^1HD$HٝHD$IHl$mHHT$HHHVHL1D MPH5C 1RQ1sHSDL$8AH0AEH@IHH$H{P3H|$MHHL`H-MLDM9A?tI1ɺH5C 1AMMLGC 11H5B ALr1ɺH5B DHH! PL C 1AQAZYt$$Mtb}tYL}LT$(LHMH5B VLB H5]B t$(L$ Q1)1RLT$HAMH D$ jKH$ʁ@t8vaHEB t'HDKtHCH\HEH5՛HB H A HDH5HĿtɃ H_gH[HEDLQ 1ɺ1H5mA A@LopI}9H8[]A\A]A^A_fAVAUAATAUHH=1SLu`HLEDLH9HHBHiL r111LH5@ AH5\1EDHH[]A\A]A^#L )1SH1LBoH5@ 1A[ÐAW11LA AVgAUATIH5Z@ UHSHHɖ111L+A hH5,@ 11Lf iH5@ 11Lx jH5? 11L kH5? 11L lH5? 11L mH5? 11L0 nH5x? 11Lj oH5Z? 1L pH5>? 11L-1qH5? I<$DL? 1ɺs1H5> 1L? 1ɺtH5> I$E1DHD$IEfMnI}Ht!E1;II}M|HuM9MBI EEuL|$Ld$L- H}gMwMΜfDII>M9wtH}H5v追tM&L蠔H}LH衽uLA 1H5= L> 1ɺ1H5= H-y1L> 1ɺH5= 1L> 1ɺH5p= 1L 41L%w> Mt8HHu1Mປ1H5)= LMY^MuL1ɺ1H5= H-1L 1ɺH5< 1L 1L%= Mt:f.HHu1M1ɿH5< LMXZMuL HL1[]A\H5g< A]1A^A_AH}H5? H}ʼALIL@t<HW< t'HVEtHUHVHEHL< 1PH5; 1AwI AVDL$(AH}LH A?:L1ɺ1H5; Ht H+aHUHEiL H55; L>? 1H5; Cff.@AWIAVAUATIUSHXH?Ht$ HT$(LD$DL$@[HLI7I<$pH5L IIEHDIFH<@HpL IHI<$EH|$H_躐HD$8II9c1Ld$0L<$AD|$@D$Ll$Hl$DHEH9$DHsET$H@M,IuEuHHt$FHt$HHHD$0H8>ET$D9T$DD$ImAED$fML$$Lt$L]> L1H5.9 1AI<$L1ZL袏HX[]A\A]A^A_ÐL y111L H58 AHL$ H˒HIEHD$(L(fDHD$0Ld$8DT$Ht$H8L9D$DT$ImAEAEAD-D$|@LPHHHpI<$HL$ HIEHImH{E詎HEHD$(L(Ll$Hl$DDLd$0H LE11ۺ֒LLt$ML$$AI7EGIAT$LHIFIT$HPIE9D$@tI4$HHt$Ht$HHH$H8EGE9DD$tJH$HT$8Ht$H8̶IDD$LHIF\$8HhjMILt$L$$IEILHhI<$H5': bL1L; H56 AVfD1E1L 1L H5K6 AL1L8; H56 A@I<$蒶HL$(IEL)HL$ HfLl$HLd$0L: HD$8HHD$1ML$$Lt$ff.HAVAAUMATIUSHwHHuffD9.tL@H HsHtKuƒtDtMLD&t[]A\A]A^@Hvf.[1]A\A]A^1fU(SH^HHt6HktHH[]@H{HH[]DL 11L{ RH5k4 AHH[]ff.fAUIATIUSHH興t3LNJHLHhH襏1҅uH<+LS1҅H[]A\A]ff.@AWAVIAUIATIUSHxVdH%(HD$h1ƒtfL 111L4 qH5p3 AHL$hdH3 %(Hx[]A\A]A^A_@H^L~I9LHLItHL9uAT$t@@@I]I9u HL9tMD$HCI9uH,L{ L \1uMN`pMAP`@(H<H%ML9@(vV===L LL͈111H592 AEDw uI@M?LPHL|$`HD$M;Mvr ;L/ (\H^L~L9oLHLmHL9u`@ `uL;|$M9 2I@LLD$H8LD$A@ @D…%D1fLy1A11L ,H50 ADI?1@I@H0 `L h!DI@MLxHLT$`HD$MlMG  h0LQ f.IHL$` Z1L;|$tn E1HL$` L\$ILT$_LT$MN L\$1M92L;|$1M9!IHL$`  1L;|$E1HL$` L\$ILT$hLT$M L\$1M9I@HHD$@ƁL 111L H5e. AqI@ALxD$`MwA8vn zZL U t`M|L;T$1M9! `uf/w&f(\f(fT ӵf/f/_\ õfTf/a1Zf.!fD1 1L;|$`HLL;xu0LHH/|uH\$l$ Lt$(Ld$8Ll$@HD$HHD$H9D$vH\$l$ Lt$(Ld$8Ll$@H|$LD$JIOLD$LYHMHL$A@H1%@D$0Ht$ H9L|$Lt$HLd$PH\$8Hl$@Ll$XM@L9%HD$ E1HT$(AAH@HHD$|DHT$(MHI݉fDHLH;ju%HD$H|$2HH0zEDDAVII9s‰DLMHD$ HHD$ H9D$OH\$8l$@Lt$HLd$PLl$Xf/~֭w*f(~ȭ%Э\f(fTf/Jf(f/\fTT1L;|$H\$8l$@Lt$HLd$PLl$X=1L;|$1L;|$\ IfT11f/1L;T$1L;T$f/V1f/f(\fT,1L;T$YLD$Ll$0H\$l$ A@Ld$(%@D$0YA@%@D$0BDAVIAUIATIUHS袥Ht"HI9tUHLLL)$HCHuFL dz11L , H5# A[1]A\A]A^H}HCHL[]A\A]A^ff.AWAVAUATUSHG(€W(uH[]A\A]A^A_DHH?HÅ^H]@Le@L9{HE1HcHHD9LOL9uILxIH L=/$ U@K1LLLAsHcSH}LZ)HLt{HL9C)uC,Hy1uHU`CH@HLL0E(uH}1LulL x1L H5$" AHu0H}1蹡nrL px1L H5! ADL Ix1L 1IH5! ADvIH@H}H5$ #u?wL w1L' H5L! AL1wH}H}跡Lw11L<IHú}1H5 AH}H޻*LrwDU1E1L Bw1L# H5 A_L w1LA 1dH5 A1hL v1L1 H5V Aff.fAWAVIAUATUHSHHHL%v1P,uLg`HHt HR:sDk(A LeAHHH@L-! 8_fI9sHLL)MAąhH;L2H;H5LeL"yH;HHuL1AąLFhDxP(EwMc`8LsHH1MEDH) LHoH;IcHY4LH;H5$LL/L t1H5I 1E1AHD[]A\A]A^A_fDH;L1˝AąxDk(1AAFHAxtfD@H@HI|x4L IHSHsH;1PAąL9L s1H5r 1ALsLT$ \rT$ HHt IDIH;1ҋ@H@HIt賜H;H53藜sH;H5u{WH;H5_;IDk(LmL s1H5u 1A*f.HHZH@8MH;H5{ߛ1L r1L/H5 AHE1rLH;1H苛AąutL?:fDLpHH1MEDH LHWlxsH;IcH%-Dk(Z@LqH;H5 GLSAąDk(AI%fL L xq1H5 1AfL DL zWfH;H5. LL q1LH5q AhLyaf.LY+LC[H;H5- 谙AąNLMXff.@AUIATUSHHH>uQ?DL%\p1u(I]HH[]A\A]; tH;t1҉HL3tDt 8uQf8tDHuL o11L H5 AH1[]A\A]I]HHC[]A\A]DHIE11L(LGIwNI:LAI9tt<_uIAAI9uHHtD@HLn11L jH5? A1HE1@AWIAVAUATUSHXT$AH|$dH%(HD$H1HD$ H$,u@IA,t LHEt<,uHL)H+PLD$@-H$1L% n1I|$PHD$LE1Lh "DAFH<@IHLHPsH4$HLtDD$L$DH|$,IAHL$HdH3 %(HX[]A\A]A^A_DH-Am11H|$1ҾnLp11H5 UH1AWAٹLnH5c UX1ZkD$@IHsHH-l1L 1FH5 URIHsD$fDH-ql11ɺK1LH5 UDHD$L``I|$PtgHH LhhE11HL$AFH@IHI|Pt9I|HT$H4$&tDD$L$1DH|$zIqH-k1@AWI1AVAUIHHATUSHHLD$H\$HdH%(HD$81H-k1H}PMe HE1!@AFH<@IHHHPHLH\tHD$E7AHL$8dH3 %(DHH[]A\A]A^A_fDD$Lj111LBH5= ADL$Im`H}Pt`Me E1Mmh1!fDAFH@IHH|PaI|LHAtHD$E7A1E1)hoAWAVAUATUSHHH|$T$0dH%(H$1HD$\HD$HD$XHD$ HD$`HD$(<,uH<,tIf.IAt<,uLH)ILt$LD$HHHL$ L|$0T$\t$XPH vAFH\HMi1 HL$ ЉALKH$dH3 %(HĘ[]A\A]A^A_@1H|$1ҾL%h111LHljH56 A$Hk1SAL H5 A$X1ZefH5H|mHuD$ID$4HD$HT$(L1LLppLl$(AUI!%tDIULDHD$(II)I~L$4H\$HLMHl$8IŃL|$@L$4@|$4t; L$H H{tXHkHgLHLxILluM9tK|=H5hluIM9tH H{uHl$8L|$@H\$Ht$7L$0HD$tA|$ x@H|$1,HfDHt$HV` HP`E1HzPHDt$Ll$$fDAD$IH@HHHxPbD0t11DLHIU`Lt$Mn L~fD$4IAFD$MEȉL$ Zkf.AWAVAUI͹ATIH=6f1UHSHHt$dH%(H$1HDŽ$HDŽ$=2=H|$HD$HHDŽ$HHDŽ$wIƄeMHD$ HfHBu _t-u IAuM9GLH$LLL)L$L$>$$H@HID$`HD$0H$1LH= f1D$H$HZD$%D$HUHD$0DxD$fD$t AOAGAH$HD$@Au'H$AHDHD$@f.I$$AHL$(HD$XL$(HHD$8%I$D$HDŽ$0HDŽ$pH<"A<'9L$0A DT$PH$pLHD$(HHSHDT$PE#fD;2H HSHtAtL$0L$pD1M)HLſHtIH$0H$H$pH$Ag|$%A EljD$HD$(D |$H$H|$(LD$y$LD$HEH$D$L5`b1HD$(H$HD$ uMt$`IL$@It$@H9uH H9t;Q,uAA9uH@HIDHD$D$#A(I$HL$8LD$0H8ԌLD$0HL$8HII$HL$8LD$0H8蟌LD$0HL$8HHIFHƨI$HT$HHL$8H8LD$0LHT$HLD$0HHL$8HBD$IAFL[uM[L$p t1I$DLL$pH0AӅL$pLD$(L+D$ D$IxLD$1_LD$HH$p Ht$ LHLD$fiLD$H$pBI$I^H8{HH$pK`IFH8I$H8HHLsHuLfHuH$1L*)HH@H$ HH=_1 HuH$H=_1ݾ5MtHI}LH$dH3<%(HHĸ[]A\A]A^A_DAA1LyL-2_111LbH5 AUMLH5s 1AUAL 16H5K LL$AU71L~ H5# AUHD$1HE fDHuL$H=^1L訽H$1HL'HHtHHu LH=Y^1dD H$HuUH^1HD$0@$AA1LL-]111LFaH54 AUMLzL]1LML OH5 AMt+HI}LHLH$HI$H8IHupfDAI$LM1L-\1Lc H5C AUfL\1LMLi _H5  AL$0L$pDM)uDA@@hA{ AH|$@H|$8 @"1ɀ'H$H$A HHD$(HH$H$H|$XH)gIH9HfDŽ$$H$H$H$H$$HD$ $IHDPH$pL HHD$P]H$pI?-@HL)HJ!HU!Hb#LdHHHHHL'IHHIIAH HqI&H JcDH9R۸$DAlAD$D$fIHHHD$ HDPHt$PLǺ LD$8\H$pLD$8H?:HL)HO"H#"H!HAdD$HHIHHIHA'IHIHHRI<H<3$D$${\$HHH"H|$ H1HDr@+@- HAHt$PHϺ HL$8[H$pHL$8I?:HH)HHLdHHIH<IIiHkHc$@$<$DHHHe ;t$<Lt$@1H|$ DD$ALL$0TLL$0Lt$@IFHLTDD$LpHD$@LpEH|$XL}D|$AAD|$HD$(1E1H$$@ ($DP$8$81$0:$0$4:$4@AHD$81E1H$HD$(gAHD$8<"> <'6 11H|$8H$H$A $0KL$HD$(HHD$0L-|V1 LuLHH51AUHDŽ$L1ɺ$1H5AU=fDA  H|$8H$H$蜴HD$8HHD$88% H|$@H|$8H$pH$01XHL$@HH A@H$pHD$8D |$AD|$HD$81E1H$HD$(HL-QU1@H$HD$@6fD+([}{H$HxA H$HD$(HHD$(L$1E1HD$@H$ A@~4AADARAxA 1"'H$H$1HA HD$(HL$1E1H$HD$@XL-S1L1HDŽ$H5*AUDI$xDLLD$訵LD$HH DH@HAA D$ADHL$8HyL-)S1LL$1L~ H5AULj1ɺ+1H5fAU>@LR1LML VH51A I$Ht$ LL\$(H83}L\$(HIH$p D$%@vn=O==L-.R1LL$1LC?H5AUfDI$LH8yK uMFMHIIt ISI@HI$LH8dyr|$IL$AN_fD$%=D$IE1AFd$@]4fDI$LM1L-Q1LH5pAUfDL-P1LL$1Ln H51AUL-P1EKRM]HHP1LHL1 H5A[L UP11ɺ/1LH5AHD$0 L-P1L4LH1H5AULg11H5cHDŽ$AUDH|$@p H|$X HDŽ$HDŽ$0EwIHHH\$8AGH$pHHL$PH=O1HH$舮_<" <' 1H|$8H$0H$A HD$8H5 H$0H$LH|$X- L-N1L71ɺ_ H55AUHD$0HXHD$8H|$XLH$MvIٹ L) @n)dH|$@HD$@0I$HT$8HL$0H84yHT$8HL$0HHBL-N1LL$1L H5^AUEL-M1 KRHIT$`M]H(L 9H@LDHLRd 1H5AA_L5XLL$ 1H5AU>I$L.L-'M11LMH5AUH|$@qHD$@D$IAFID$`LHAL-L1LL$1L H5AUHD$8L-{L1LL$1L H5AUNHD$0 L-8L1LLHMIFIHISH@HH|$@ HD$@E1DI$HIFHɿ(1L-K1LdH5AUIFMy LISH@HIVMIH"IKHBHIVM AiACHBVHƄ$0%A^HD$8Q=DHD$8xLPfH$\$(L$0LHD$ M蘩"1ɀ'Ht$ A LHHHZHT$P H=yJ1HH~ H\$8\$(9 L CJ1Mt';@J1tHGJ1DH;XtLMuL-I11L H5BAUHD$0HXH"AWSH$0H$LH|$X$H$p?IH\$0LT$1L-@I1L H5HIAULT$LT$8gfDI$LM1L-H1LH5PAUL-H11LP H5!AUHD$8H$HD$0HXL H LDHLR` L-NH1HL-BH11L1ɺ H5AUH|$XLoHD$0HXIL A@[HD$@HJL-G1LL$1Lp H5+AUL-G1LL$1L H5AUrL-kG1 Lz1H5AUHD$0HX.H$H$HxHD$(HH$H$H|$XH)qIH]eK1 LHMHYHL$@HAHAL-F11ɺ 1LH5AULY1& H5AUHDŽ$L-EF11ɺ 1LH5AUHD$8AGAu1DAGH$0H$LH|$X(l L-E111ɺ L)H5.AUHD$0HXH|$@o H|$@INHG?Ht HAHWHI$E1DW"81L-9E1L*H5AU"L-E1L1ɺ H5AUHD$0HXAGHD$8L$H$HD$@L8MH\$0[ L-D1LH5HIAUHD$0L-D1HuL 1}LHMUSA PLEʃ H51AHDŽ$_AXHD$0L-"D1 LLHL-D11ɺ 1LcH5hAU^LHWH)HXHD$ HDPHL)HDŽ$LDŽ$葢HHT$ LL$GLL$1HLLHT$ ;"2INff/f/YE1DI$,HHL-B1L$p1LhH5KAUHD$0L-B1HL i{LHA MUASLEP 2LD$ LL$FLL$ 1HL)ILD$ IHu ;" I^E1 DI$H#'L$pWLE1LɺI$DLL$LL$ 1L-A1LH56AUHT$ LL$"FLL$1HLJHT$ ;"UH|$@%HD$@INHHtfH*Y<YE1DI$@D$D$L-A1LRH5gAUL-@11ɺ%1L1H56AUF1LH5AUEAuLdHHHLHHHJ 1L-/@1LH5AUL)AHWI)HD$ HDPILHD$ HWHDPH)HAAE 1L-?1LH5AUKL-?1L7t HA+ 1L-M?1LH5AUH.E1D$8uL-?1APt$L$LH5o1AUAYAZHt$PH$H$e@H|$P:$tH-T$8+$HL$@HH)I)HYLqL-}>1L1ɺq ];"RH\$8ML-O>1L(1z HH5SAUY^LH|$Xe HOHt$P LD$`HHL$8@HL$8LD$`H$pIHH)ȹII)Iڀ?-/JL)IHIAH  1L-x=1LH5AU 1L-K=1LH5AUHt$PH LD$ ?H$pLD$ HH$1L_Ht$P LT$pLHL$hLD$`L\$8?L\$8H$pILT$pLD$`HL)H)Iʀ?:HL$hJL)IpHe1D$HH$pHD$8AGv AGL6IH?H7H<Ht$ :Ht$ HHID$H HHI9uHH ]@L%1Ll$ IHHHtLHA9wHLLl$ H;L-~;1H\$8z LH5AUHD$0HXH\$0HD$81L-6;1Lt H5HIAUg 1L-:1LH5fAU 1L-:1L,H59AUr> 1L-:1LH5 AUEHcHAdHIH+$@&INHЃfHH H*XL-:11ɺ31LyH5~AUCL-91L 1L H5IAUALdHHIIL_Ht$P 1LLD$pLL$hLT$`L\$8+-HD$(H$dH%(HD$h1Ht&131H @0 H HxuH HyuʾHT$3HT$HIHD$HtAGIWxADA G(Mw0Io`I_pAG(A tAYEt AG(tAG(IG@HHD$IPAwIpxH0HtHPH/HHDIW (H=0%RIH)IO`1ۀyHQpu T@HH`HszuHHSIGhH=HD$'fLH€tIHAE,AEL51 H=U{L@IMIBH€uM|$8Mo HH={€rLLCxLH3HARP4H|$LizMmL;l$FDl$HHtqHpHthHT$HcuWAD$0IT$8Ht5HBLCxLHH3@H@HH1PPID$8H@@)tC(@DEH@s8H;HI=ID$(HNL 1L3H5A~fHC IE Ls`MoH<$PHAULRIMAJHIB@IL<L1H5 1A1HtAT$0UH;L$'9$LfL)f.AEH@HIDZf.L 1LR1H5[ANAELH@HMLH{PLxC(tHfAD$0EYH(H[]A\A]A^A_mHtAD$0EE-ff.f1ɺGkATAH=US5HtW(HH:HHtwD L`HhL$w@H:HHLcwH[]A\L 111LH5AH[]A\DL Y1L1H5AH15H[]A\DL 1LH5}AHAUATIUH@SHHH9IHHhHtE(AE LHCH{I]Me8H9uHH9t HxuIE(L%v *uMMtIELHx8IE8HIUHB(ڃB(H[]A\A]fL 11ɺ~1LYH5^ALuH{L5H1[]A\A]fIUHBHH9tHxHH9umH-x 11LbH5ڶUL11sH5UXfIEHt]P( ⿉P(fL 11L[H5[AH1[]A\A]MIE(DH EL 111ɺ*L LH5AlIED@ Eu Hx 3uMt'IELHx.lAM0*IE(H-, 1Hx(LUIUx DJ At=H1ɺGHDH5hPLX1AIELUY^DH AHH1ɿH,L{XPH5#1AIE@ XZM3H- 1LH5UL՚1ɺ{1H5ѴUnH-A 1L1ɺ@H5UL1CH5Aff.H>UHSHgHH,U1C0<H{8tEHSHL 1H5LFWB HDH1J H ?Q1AY^HC(Hx8tLHx(tEHSHL1 1LVH5B HDH1J H lQ1AXZc0HqHCHtS HǀP(HC(Ht@ H}Hu1H[]fL 11L3H5AH1[]fDAULoATIUSHHGH(I9u<]DHxHt*ÅL(ÅtRHUHL9t&HHx(u@ HUHL9ufA<$tdH[]A\A]L)1ɺL 11H5AH[]A\A]DL1ɺAD$ u I|$ -qL V111LjH5AAl$ H[]A\A]ff.@USHHtH1H{@s.H[]f.7H@u!IHHHHOr@t*HHP@-uքtҀ-urHH@uHff.@AWAVAUATU1SHt~HIDnA;@ugH;@tZ uIL;Et)HH L;HEtHBDz tAHEI9t;HA@uH[]A\A]A^A_D@HATIMUSuUMtPHLHtuH0I$HHHEHHH{[]A\ÐLcL (11H5A[1]A\I$HukL 1LH5wA[1]A\fLuhff.fSHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$IIHD$HD$ HH$D$0HD$x'HcH9ںCHL$dH3 %(uH[ø S/HHxHH[HEff.AWAVIAUATUSHH8H|$H4$dH%(HD$(1HHIŻHl$E1A4DL>AGEILcLIHAAoIFLIL$HLEHEzA9sA-HD$L(AGHL$(dH3 %(u@H8[]A\A]A^A_fL8HT$LHHt@ff.HHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ D$0HD$(HL$dH3 %(uHff.Ht'H1f9HH9uf1ff.ftE1ɸ@"tHTt\uHTuHcHf.f.AVAUIATIUHSt"f.-HTuA$t&LH)f-HuMt AUHcHH)IHdUHƄ-DHNHF-uHV-HHHHUUH΄u-A $fDHP-u HH-HHIAL$A $HЄuMtZAMtQ_-AMHBHP-u HH-HHIAMAMHЄu[L]A\A]A^@MI)f.N-uVΉHAuDHLH@-A $ fH&HL0I1AUL`ATH5[UAH JH?fAVIAUIATUHHSHLIMdHtkHHIL'HHtm;HgHHDSHMMPH OH1cXZ[H]A\A]A^DHLH&HHtH멐L0SMAUH5f1LѮ1AY^ff.HHu'=D"t$LIHHVAtLA\u\HfDff. f.HHGPta\u"t\u߈WLGHOuCHHqt/IH\uAp@\t@"uIH@LOHE1E1u-VfD<:ulM:LLDHALOt+<\uG<:t<\t<@t\LDHfHtLHtL@<@uMtLfIʸ@fDUHHSH1HHt H[]1HtDH[]ff.AUAATIUHSHH(dH%(HD$1HD$HtH}H HHDHunEtu5fA$3V2w#H "HcH>f{t1H|$dH3<%(4H([]A\A]fHt$HCH9\$t1 HD$D$HxLfH*\-fT -f/vfH\$EHU'HHfHH H*XfHtHH]f(-fT -f/H@Hd @H@H@ff@nfDHYHI>fDHƤ~)@BfDfDA4$Dʚ;fDfH*Y |f/s H,\H,H?D;X{N rAWHMAVAUAATAUHH5=0SHL$H\$0HDL$dH<%(H$x1HD$/HH!HNIƋD$*MH8H1BHH(s 9HuH$89H$P9H$h9HH AH}ARsIDD$EDHfH*I91fL1҃HIǃwH9wL 1HRHD@HBt 1S@$HRHHL0MfI*^QLVLبHf(NXZH$xdH3<%(LHĈ[]A\A]A^A_HH1HxD8)Hu1HD8*HuIMH8BIH fHHuHHt'HHD$1HT$H5Z|AǃH-01ɺn1LH5}UL ħH1SLH5JUXZI$E1HT$dH3%(DH([]A\A]A^A_fH- 0Lr1ɺiH51UL jrfDHLHL$HI H)LHIF(HD$LpHcIF0HHIvIV(IVHIN MNH51w_AXH-D01ɺ1LH5/UL ~H1SLH5UYL^LDH-0LB1ɺxH5ƥUL <H-0L1ɺrfDH-0L~1ɺuH5vUL BH*HAHHD$LD$H!L)LLD$HLD$HIF8bHIN1LH5mH-0L=~1ɺH51UL fM4$I^I;^VHcT$1ɍBHfDIv0<a@ƃH@pD$܅A9N  In8H5YHtH5~HHI^H-0Lb}1ɺ =HHtHIV@H5S1 L H-0|H-0L|1ɺH5UL LDAWAVIAUATIUHSH(dH%(HD$1;HtnH5HHHt7IHT$dH3%(H([]A\A]A^A_DH5IHHt<L 011ɺL|H5A1fDHD$HKHPHC(HSPHC`LK PHCXLCPHCPH5PHCHPHC@PHC8PHC0PHC P1THP HIHD$E12DHKhLIHAD9|${ LH=9t LH=-HKhH4LHCxHtcLFIHtNHLIHt;DCpLDDD$ IHtDD$ HKx1LD9Cp1IXL0LH5AHLI1 LH=OuHKh@ LH=4uHKh@LH=HKh]1HSpH5$L["HcCpLIHHLL)HHHH1LH50HcuqH5LHtH5LHyI.1Lj0L&H5YA\H4LOHHLIHHLkHH1H9DAUIATI UHSHHHHHLHHL@H51LuI]H[]A\A]f.M1vLJ0LcH59AHHH1[]A\A]@L 011ɺoLqwH5AH1[]A\A]DAVIAUATIUHSH oFdH%(HD$1)$HIHHHHM1H5LtZ1ML\0LH5KAHH1HT$dH3%(ukH []A\A]A^@<$-uBHCIL 011ɺLYvH5A1fD11LHCfUfSHdH%(HD$1FF F0Ht^HH5HlHt'K8HT$dH3%(H[]H5H1HtItHlL9uLH|$MIIwl$E1HD$IHuvf.IOLE1ɾH H1)HID9vA|IIFM9uHt$H|$L,HD$H>LT$HL$LS8HyHqLS0_CHHt$$D$$C HLsLH HCHs H|$HHC(H:Ht$H1SDSE8fDs H{0HHHs H{0Hk@L@~HPHuMfDHI9cs H{0~HEHuH-0LY1ɺH5NULX1ɺ1H5/UH|$H1 HL$(dH3 %(HUH8[]A\A]A^A_s H{04~ID$8Hs H{0~ID$@HC9HSs H{0L$}ID$0HuH-0L X1ɺmH5nULX1ɺ1H5OUfDmL _0LMH5A@H-90LW1ɺoH5Uf.H- 0LrW1ɺqH5UMD$E1DHSDL4AMnM~QH HcH>Iu0IF0HxHHWIu8IF8HxHH6AE$AF$AxqlK E1AuZf.AD;k sFDIV8DDLXMHPIE1E1HXHH貼 AAtDLHu1ɺIE1HK0LOH5 zLO1ɺ0H5y1HHL$(dH3 %(D=H8[]A\A]A^A_IH3H,$LD$HD$HD$ADžueL 01ɺ81LOH5cyAmf.L y01ɺ-1LNH5.yE1A=fE1DHD$HHPLpHT$HT$HPHD$MAFMnAIFAID1IuLI1AM9uyf.ffHHt'tuHtHuf.ff.@9USHwSHHHu2fw3HHt!H[Hm ;Mt1H[]f uL u(L 01ɺ1LQMH5xAH{GuHu-sHuH{CtHuH{2u1fAWEAVIAUIATUHDSHHHA9w!_HCEHDCHA9tQ;uA9w#DHEEHDEAHD9s }u1H[]A\A]A^A_rD9uEu,אEtHEHSEHESHEEHHAtu'EuEH{HuHE{HEu u uvI]I.gff.@AUATUSHLgHO L9A4$HI\$FfG1H_HHH HEHH[]A\A]fH_1GHHHʷHEHH[]A\A]fwH_H[]A\A]fH_GHHHgHE`H[]A\A]@HGHxHA|$^(1!1LU L9 1A]ub5D-?HEHHAʃHHEEAыA A!ɅEDDI9N]Hs\uSHrtenDEAHDH9L 0L9u1H5uAEH[]A\A]H}E1H]HHA $HH5qA1H[]A\DL'HLHH|LkHEHRHsEHxHEHEHH.HfDC+?*tV|XHIHDH;HHHhHL`H[]A\f.H;HHtNHhHH@@H;HHtHhHH@o@LD1ɺeL K011H5CpAH[]A\LD1ɺ|HLDLyD1ɺ4ATUSHHHt{|tH[]A\fDHHIHt`H;HHtHhHL`H[]A\DL 01ɺ1LCH5zo1AfDL Y011LoH5@oAJAWAVAUATUHSH8dH%(HD$(1>fIHpHIHvHcHL>LDC1ɺBHHCHHsLL~LC1ɺEHHCHL|$ Lt$H{HALL;u HC8Lt$HLL|$ IFHD$DHHhHD$H]HEIFoAoHANoP AV oX0A^0H@@IF@IGo A'ohAoop Aw ox0A0H@@IG@A$fHL$(dH3 %(HH8[]A\A]A^A_f.;LA1ɺ<HHCHtQH@LA1ɺ1HHCHt)HsLLHHCHuLwA1ɺ4L 0H5l1ACHsH{E1LLJq;uUHC8uLHPHHSHPHPHSHPHCHPHHSHPHPHSHPHC@Lt$ HLL|$IFHD$XHH|HXHD$HEIGoAoHAOoP AW oX0A_0H@@IG@IFo A&ohAnop Av ox0A~0H@@IF@L 01ɺ1L@H5kAAVI(AUATIUHSHdH%(HD$1mHH(HIaeLkHIEHtsMe LLd$MuLLjHHu;@D$tRHLHD$HHuLjL 0H5j1ALHNHL$dH3 %(Hu=H[]A\A]A^fDL a01ɺ}1L>H5Rj1AifUHHSHH8HHHH[]sHGHtStKHLDHVHHHt;rvHHHuÐH@Ht H9uH@ ff.AWIAVIAUATIUSH_HHGIAnfDHX;(r HXHHuAfD(HEt A.HXIAAI(HuL 011ɺ[HLL=H5jAH1[]A\A]A^A_@HXH@Hi4L` H[]A\A]A^A_Hff.@ATAUHShHHtD HhH[]A\ÐL 901ɺm1L<H5:jALjIrE1MI)H9t't'8u#tH8LuA L9utAIAtA1ICD ff.H9tw?ou6ILkI)fDtH:LuA L9ut??ou7H)LjfDtH8LuA H9u1tÐ11H HADøL{jfLjIeE1MI)@H9t+t+8u'@tH8LuA L9utAI AtA1KRADff.ATUHSH9tCIH赫1H0fD0HHHH PI9tHHDVu[1]A\1[HM]A\ff.fH9tBUHSHHJHH fHH9tHDQ tH9źHDH[]1fDH9t6UHSHHHH fHH9t HDQ uH[]HÐHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$IIHD$HD$ $D$0HD$JHD$dH3%(uH轮ff.fAWIAVAUIATIUHSHL7L$LLL$rHt]HLHLAAńt'LHHEHD[]A\A]A^A_fDH$H|$H5Pf1H$H|$1E1H5f@H9tGLpLIDhHU #EHHIL[E]A\A]A^[1]A\A]A^DAUAATIUHHSHH莛Hu }ED@LHHt HHtH@H[]A\A]fAUAATIUHSHHH.Hs {ED@LHuHtH8HtHH+H[]A\A]ff.@AWE1AVIAUIATUSHHH躚ALhfHS #CL$‰I$HD$Ht[9ku HT$HsL2u AMMDIHHuMt#IHtH@H[]A\A]A^A_H1[]A\A]A^A_ff.@fAUIATE1UHSHfIU DHHtHHxHHuAE9esH[]A\A]f.SHtCH{ 1PH舕CHC [ÐHFHFHw OHtfHu ЃH9sff.HHtOV!ʃ9rHw Hu߉ЃH9sDHH?@H?tHGH>HFHGH0HwPH g[$H5[H=[ff.@HHtHH~HpH7PH [3H5ZH=Z赕DHHGHBHff.fUHHSHHHHH[]'1H9?1H9~f1H9>SH1҅uHH[DSH1҅uHSH[@SH1҅uHSH[@SH1҅uHH[DH1H9tfHH9u@ff.@USHH?tnH>HtFHHtH[]ÐHCHUHH(HHPHUHHCHEH[]H JYH5YH=*YH +YH5XH=YATDbUSA9tp)HHLH֍qHHLHH<蔙1rEHUHEHDHH)r1H4 9r[]A\fDutEt1fDEDDHH9t[LqX8wLIc L>LHEEt4DE8YpHyE8\9)HA9wH@HxL/wHHHH9uÐLHA tDE:YDQIHyE8\9HL9uLHHH)EYL9iEt5>A8yWES1|HA:| 4I9uLLM@H@H<>LHHAL9HID9f.HHID fDHHID 11ff.AUATUHSHVHwIHcH>L&I\$IHL9t_Ct{HHu1H[]A\A]ÐHt/LE1DHHL8HpetAD;+rH[]A\A]HEHHH[1]1A\A]fDL&11HI $UkA|$It$ H6>HfHE13LctDHHL8HpAD;+rFfDH 3LcE1DHHL8HplAD;+rfDAWAVAUATUHH=USHHcH>Ht7LcE1DHHL8HpAA9rՃwHHlPHHHHD[EguH[]A\A]A^A_@L6E1I^MDAHL9w{tHHu1H[]A\A]A^A_H6>HHw,1HWH;H H=WvH1[]A\A]A^A_DHt;LcE1DHHL8HpX_AA9rՃHHDTEdPHHHTHDJE?ufL.E1E1AEMuIRfDIHAHHI I 8HpAEII9'A/w9rH,(H=SH41 DEH[]A\A]A^A_H6E~H5DH,ѾH#UH8191fH,H=(SH谖1fHi, H=SH耖1VfAD9Amt+11ۉLHIHP0A;]rL訌[]A\A]A^I]M1HS3LHnI9uHGHtH LHGIuHtH IUAuL.Lh3[]A\A]A^IUAu L[]A\A]A^AmJ11ۉLHIDHP0A;]rAm11ۉLHIDHP0A;]r1ff.fAWAVAUATIUSHH(H9t%HHNHcH>tjLD$H1Ht$oLD$HSLZA$H([]A\A]A^A_fH)IͅLCA$H([]A\A]A^A_ULnHHATHUHItttAEz9LCafHvH(H[]HA\A]A^A_fLnE}EAU8UIII)E9EBEAQH@HCAt@8tu HAH9uDLD$HHL$H)DL$艏DL$HL$HILD$E)ItHxLD$DxDHL$DL$AoeDL$HTLD$HL$LLA&AEMuEM5LD$D$LnAEOHHUItmtIAMuHAt AUDLnAEHHUIt%u1fLnAE0HHUItAUMAT AU\DLFNDAϿLD$IwI1MLD$EnI~LAHMFLsA$LD$HL$臍HL$LD$HIfoN1@@@$@4@D@T@d@t1AtAD6AoTHAHHuEHUILADZD$LƆD$LsfLD$HL$wHL$LD$HIAEHUIvXLAFAoeEAfAomAn(Aou(Av8Ao}8AFA~HD$CLD$LsLD$HL$NjHL$LD$HI11HpIUHMfHIAEIM1IT$M$A$D0HHL9t-to@:HHHHAD4L9uLEL#H[]A\A]H E_H5cGH=?HWAWAVAUATUHSHH9tXw;HH)EHcH>LnEtEA/vfD1H[]A\A]A^A_'uH^HGH3HtH oCHE H[]A\A]A^A_LfHSHIt'wHATuA<$WA$0wHUHLD$D$HUHLD$HMeHSLlDHHAtAUD9AUHUHLD$D$lfHMeHSLLDHA|AUD9wstQAUn1E11E1fDHE1H=CL5C 3t(BL#L1HIDyD9#wHE1H=BÃDl$ At&DDHAHHDHP0D;#rH[]A\A]A^A_HE1H=_BL5MBUIIt*B|#/wDLH1IxIuֺHH=AhDl$ E11ADHPHtHDHAHHTD;#rH[]A\A]A^A_fHE1H=ALc`ML=IA@AIAAEtDLH1~w@HHH[H@]1A\A]A^A_QwH H@H17wDsH[AD$ EL*H E1H=x@Lk萁DKEt0DHAALHM@1vD;srHH= @>D3H[cfHE1H=@L5@ DEt&DBL#L1HIDvD9#wHE1H=?ÀDl$ ;A"DDHAHHDHP0D;#rH[]A\A]A^A_HHH=)?[Dl$ A IL9A4$tIT$DHH R<H5=H=?uf.AWAVAUATUHSH6H9$HH;HcH>HMeHSLtyDHELEuAUD9AUDH[]A\A]A^A_@LeHHAttHHSIt7H1[]A\A]A^A_fDLmEtEA/wAMHSHLtDHHA|SIAD0IU /w A8s HH9uAUDLD$mAEPAUHUHLJD$LeHIt$?E\$EI$ELD$HU>vD$@LeII)ET$E9EBEt6AD$8_Aq1THA:TAUHUHLD$7D$j1E11E1I}DD$AUDLAUD$LD$sED$I}DD$VAUDLBAUD$@UH(SHHqHt@HhHX H[]DSHWHw H[sfATIUHSHHfMHHH[]A\QSHHHwHHu[Ã+[ff.SHHwHHdH %(HL$1LD$HHD$5D$t)HL$dH3 %(uH[`wUHHSH1H9t []t!uH@HHEf.H@HE뽐UHHSHHG8H9tMt H[]@L@H)A;Xst,AH8 uDK1fDAtH@:4 uI9uHHHp[]SHwHHdH%(HD$1HT$D$t DD$D9uHL$dH3 %(u,H[DH,H6H81n1uf.HHWw1HHHactivate/activate.c%s-%s-missing_%u_0No host tag matches %stpoolvpoolrealGetting driver versionGetting target version for %sFound %s target v%u.%u.%u./usr/sbin/modprobe%smodule/dm_%sModule directory %s exists.kvdodm-%s (no device driver)Logical volume %s in use.idleCounted %d open LVs in VG %s.Found active component LV %s.UnmonitoredMonitored%s %s for events [Test mode: skipping this]Not mSkipping %smonitor of %s.%s%s already monitored.Monitoring %s with %s.%s%s already not monitored.Not monitoring %s with %s%s (reverting) pool only thin only if activeSkipping: Resuming %s%s%s.Resuming LV %s%s%s%s.resumed temporary noscanSkipping: Activating %s.Activating %s%s%s%s%s.LV %s is already active. origin without snapshotsSkipping: Suspending %s%s.already suspendedRequiring flush for LV %s.suspend_lvssuspendinglv_list alloc failed.failed suspendSkipping: Deactivating %s.deactivatingdeactivatedFound active holder LV %s.locking for suspendunlocking on resumeunlocking on revert%s configuration setting defined: Checking the list to match %s.No item supplied in %s configuration setting matches %s.Ignoring invalid string in config file %s.Ignoring empty string in config file %s.Ignoring empty tag in config file %sactivation/volume_list configuration setting not defined: Checking only host tags for %s.module string allocation failedsnap_seg module string allocation failedactivation/auto_activation_volume_list configuration setting not defined: All logical volumes will be auto-activated.Activation enabled. Device-mapper kernel driver will be used.WARNING: Activation disabled. No device-mapper interaction will be attempted.Activation disabled. No device-mapper interaction will be attempted.Failed to get %s target versionmodule_present module name too long: %sInternal error: Target present version called when activation is disabled.Cannot determine activation status of %s%s.Found suspended LV %s in critical section().Found suspended layered LV %s in critical section().Snapshot merge is in progress, querying status of %s instead.Logical volume %s is used by another device.Logical volume %s contains a filesystem in use.Retrying open_count check for %s.Checking transient status for LV %s.Checking snapshot percent for LV %s.Checking mirror percent for LV %s.Checking raid data offset and dev sectors for LV %s/%sChecking raid device health for LV %s.Checking raid device count for LV %s/%sChecking raid mismatch count for LV %s.Checking raid sync_action for LV %s.Thin pool data or metadata volume must be specified. (E.g. "%s_tdata")%s must be a RAID logical volume to perform this action.Unable to send message to an inactive logical volume.Kernel driver does not support this action: %s"%s" is not a supported sync operation.%s state is currently "%s". Unable to switch to "%s".Internal error: Cannot check status for unused cache pool %s.Cannot check status for deleted cache volume %s.Counted %d active LVs in VG %sRAID module does not support RAID4. Cache pool activation for clearing only.Skipping unmonitor of opened %s (open:%d)Skipping monitor of snapshot larger then origin %s.WARNING: Failed to %smonitor %s.WARNING: %s: segment unmonitoring failed.WARNING: %s: %s segment monitoring function failed.%s %smonitoring still pending: waiting...WARNING: %sonitoring %s failed.No degraded or partial activation for raid with integrity.Refusing activation of partial LV %s. Use '--activationmode partial' to override.Refusing activation of partial LV %s. Try '--activationmode degraded'.Cannot use partial or degraded activation with writecache.Refusing activation of LV %s containing an unrecognised segment.Refusing activation of RAID LV %s with visible SubLVs.Internal error: LV %s missing from preload metadata.Internal error: LV %s (%s) missing from preload metadata.Not activating %s since it does not pass activation filter.LV %s has open %d snapshot(s), not deactivating.Failed to remove temporary SubLVs from %sDeactivated volume is still %s present.Releasing activation in critical section.Activation of logical volume %s is prohibited while logical volume %s is active.Cannot deactivate logical volume %s.Cannot deactivate subvolume %s of logical volume %s.cache/lvmcache.clvmcache %s: now in VG %s %sNo size for %s./dev/mdnot chosenis inis not inis nothashas nois used foris not used forof previous preferencedevice is used by LVdevice size is correctdevice name matches previousdevice has fs mounteddevice is in dm subsystemdevice is in subsystemdevice was seen firstlvmcache label scan beginResolving duplicate devicesPV %s: %s %s dm. %s %s dm.PV %s: %s %s LV. %s %s LV.Adding chosen duplicate %slvmcache label scan doneno longerDestroy lvmcache content#orphans_lvm2PV %s size is zero.Found PVID %s on %sAdding pvid to hash failed %sdevice is an md componentdevice is partitioneddevice has a signaturedevice is missing sysfs infodevice type is unknowndevice is not in devices filedevice is not in devices listdevice is an LVdevice is filtereddevice cannot be useddevice is a duplicatedevice not found_lvmcache_update: vgid hash insertion failed: %slvmcache %s: VG %s: set VGID to %.32s.Internal error: vginfo_lookup vgid %s has two names %s %sInternal error: vginfo_lookup %s has_duplicate_local_vgname.vginfo_lookup %s has_duplicate_local_vgname return none.device_list element allocation faileddelete dev from unused duplicates %sdelete dev from initial duplicates %sInternal error: lvmcache_get_bad_mdas no vginfo %sInternal error: lvmcache_get_mdas no vginfo %slvmcache adding vg list alloc failed %slvmcache adding vg name alloc failed %slvmcache adding vginfo for %s %slvmcache adding vginfo found duplicate VG name %sInternal error: lvmcache_update_vgname %s %s %s %sWARNING: VG name %s is used by VGs %s and %s.Fix duplicate VG names with vgrename uuid, a device filter, or system IDs.lvmcache adding vginfo to name hash failed %slvmcache adding vg to name hash failed %sIgnoring lvmcache info for dev %s because dev %s was requested for PVID %s.No lvmcache info for checking bad metadata on %svgnameid_list allocation failed.vgnameid_list member allocation failed.extra md component check skip %llu %llu device_hint %s dev %sextra md component check %llu %llu device_hint %s dev %sIgnoring PV from md component %s with PVID %s (metadata %s %llu)Skip multipath component checks with single device for PVID %sDifferent wwids for duplicate PVs %s %s %s noneDifferent wwids for duplicate PVs %s %s %s %sFound multiple multipath devices for PVID %s WWID %s: %s %sSame wwids for duplicate PVs %s %sFound multipath device %s for PVID %s WWID %s.Using multipath device %s for PVID %s.Ignoring multipath component %s with PVID %s (dropping info)Ignoring multipath component %s with PVID %s (dropping duplicate)Found multiple md devices for PVID %s: %s %sFound md device %s for PVID %s.Using md device %s for PVID %s.Ignoring md component %s with PVID %s (dropping duplicate)PV %s with duplicates unselected using %s.PV %s with duplicates unselected comparing alternativesPV %s with duplicates comparing alternatives for %sPV %s compare duplicates: %s %u:%u. %s %u:%u. device_hint %s.PV %s: device_id %s. %s is %s. %s is %s.PV %s: size %llu. %s is %llu. %s is %llu.PV %s: %s was prev %s. %s was prev %s.PV %s: %s %s subsystem. %s %s subsystem.PV %s: %s %s mounted fs. %s %s mounted fs.PV %s with duplicates will use %s.PV %s with duplicates will change from %s to %s.PV %s with duplicates will continue using %s.Dropping unchosen duplicate %sWARNING: Not using device %s for PV %s.WARNING: PV %s prefers device %s because %s.Internal error: PV %s with duplicates no alternate list entry for %sIgnoring md component %s with PVID %s (dropping info)Checking for multipath components for duplicate PVID %sVG info not dropped before rescan of %sVG info not found after rescan of %sInternal error: NULL vgname handed to cacheFailed to update VG %s info in lvmcache.lvmcache %s mda%d VG %s set seqno %u checksum %x mda_size %zulvmcache %s mda%d VG %s older seqno %u checksum %x mda_size %zulvmcache %s mda%d VG %s newer seqno %u checksum %x mda_size %zuWARNING: scan of VG %s from %s mda%d found mda_checksum %x mda_size %zu vs %x %zulvmcache %s: VG %s %s exported.cache creation host alloc failed for %s.lvmcache %s: VG %s: set creation host to %s.cache lock_type alloc failed for %slvmcache %s: VG %s: set lock_type to %s.cache system_id alloc failed for %slvmcache %s: VG %s: set system_id to %s.Internal error: vginfos list should be emptyInternal error: lvmcache_update_vg %s no vginfoSee vgck --updatemetadata to clear outdated metadata.lvmcache_update_vg %s no info for %s %slvmcache_update_vg %s for info %slvmcache_update_vg %s failed to update info for %slvmcache_update_vg %s copy ignored mdas for %slvmcache_update_vg %s failed to update mdas for %sWARNING: outdated PV %s seqno %u has been removed in current VG %s seqno %u.No cached label for orphan PV %sMust be exactly one data area (found %d) on PV %sMust be at most one bootloader area (found %d) on PV %sPV %s is a different format (seqno %s)lvmcache_info allocation failedSaving initial duplicate device %s previously seen on %s with PVID %s.Initial duplicate already in list %sChanging pvid on dev %s from %s to %sChanging labeller on dev %s from %s to %sInternal error: lvmcache_get_outdated_devs no vginfo %sInternal error: lvmcache_del_outdated_devs no vginfoInternal error: lvmcache_get_outdated_mdas no vginfodevice is rejected by filter configdevice is restricted internallydevice is a multipath componentdevice is too small (pv_min_size)device is not in a usable stateInternal error: Passed segment is not writecache.Internal error: Passed segment has no writecache.WARNING: ignoring writecache setting "cleaner" which is not supported by kernel for LV %s.WARNING: ignoring writecache setting "max_age" which is not supported by kernel for LV %s.origin not specified in segment %s of logical volume %s.origin must be a string in segment %s of logical volume %s.Unknown LV specified for writecache origin %s in segment %s of logical volume %s.writecache not specified in segment %s of logical volume %s.writecache must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for writecache in segment %s of logical volume %s.writecache block_size must be set in segment %s of logical volume %s.Unknown writecache_setting in segment %s of logical volume %s.dm-writecache module version older than minimum 1.0.0String list allocation failed for writecache module.Failed to allocate memory for writecache segtypewritecache/writecache.cwritecache_block_sizehigh_watermarklow_watermarkwriteback_jobsautocommit_blocksautocommit_timemax_agewritecache_setting_keywritecache_setting_valwritecache = "%s"writecache_block_size = %uhigh_watermark = %llulow_watermark = %lluwriteback_jobs = %lluautocommit_blocks = %lluautocommit_time = %llunofua = %ucleaner = %umax_age = %uwritecache_setting_key = "%s"writecache_setting_val = "%s"Initialised segtype: %sintegrity/integrity.cdata_sectorstag_sizeinternal_hashmeta_devjournal_sectorsinterleave_sectorsbuffer_sectorsjournal_watermarkbitmap_flush_intervalsectors_per_bitdata_sectors = %llutag_size = %uinternal_hash = "%s"meta_dev = "%s"recalculate = %ujournal_sectors = %uinterleave_sectors = %ubuffer_sectors = %ujournal_watermark = %ucommit_time = %ubitmap_flush_interval = %usectors_per_bit = %lluUnknown LV specified for integrity origin %s in segment %s of logical volume %s.integrity data_sectors must be set in segment %s of logical volume %s.integrity mode must be set in segment %s of logical volume %s.integrity mode invalid in segment %s of logical volume %s.integrity tag_size must be set in segment %s of logical volume %s.integrity block_size invalid in segment %s of logical volume %s.integrity internal_hash must be set in segment %s of logical volume %s.integrity internal_hash failed to be set in segment %s of logical volume %s.meta_dev must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for integrity in segment %s of logical volume %s.integrity recalculate error in segment %s of logical volume %s.Unknown integrity_setting in segment %s of logical volume %s.String list allocation failed for integrity module.Integrity target version older than minimum 1.6.0Internal error: Passed segment is not integrity._integrity_add_target_line zero sizeFailed to allocate memory for integrity segtype Setting %scache_segtype/cache.ccache_modepolicy_settingschunk_size = %ucache_mode = "%s" Chunk size %s Metadata format %u Mode %s Policy %sCache supports %s.%s: %s failed: %sFound kernel symbol%s.fcloseSMQLVM-cache_pool_corigmetadata_startmetadata_lenmetadata_idcache_pool = "%s"cleaner = 1metadata_format = %umetadata_start = %lumetadata_len = %lumetadata_id = "%s"metadata = "%s"cache-poolmigration_thresholdsequential_thresholdrandom_thresholdread_promote_adjustmentwrite_promote_adjustmentdiscard_promote_adjustment and aliases cache-mqCouldn't read cache chunk_size in segment %s of logical volume %s.cache_mode must be a string in segment %s of logical volume %s.Unknown cache_mode in segment %s of logical volume %s.policy must be a string in segment %s of logical volume %s.Failed to duplicate policy in segment %s of logical volume %s.policy_settings must have a policy_name in segment %s of logical volume %s.policy_settings must be a section in segment %s of logical volume %s.Internal error: Incorrect policy_settings tree, %s.String list allocation failed for cache module.WARNING: The cache kernel module is version %u.%u.%u. Version 1.3.0+ is required.Cache policy %s is available%s.Target %s does not support %s.Target %s %s support disabled by %sInternal error: Passed segment is not cache.cache_add_target_line lv %s pool %sInternal error: LV %s has unknown cache mode %d.LV %s has metadata format %u unsuported by kernel.Using metadata2 format for %s.Internal error: LV %s has unknown metadata format %u.Internal error: LV %s using unsupported ranges with cache pool.Internal error: LV %s has invalid ranges metadata %llu %llu data %llu %llu.WARNING: %s cache policy does not support "%s=%lu" setting, remove with 'lvchange --cachesettings "%s=default" ...'.Cache pool %s is missing cache policy, using %s.Cache pool %s uses implicit metadata format %u.Cache pool %s is missing cache mode, using %s.cache_pool not specified in segment %s of logical volume %s.cache_pool must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache_pool in segment %s of logical volume %s.Cache origin not specified in segment %s of logical volume %s.Cache origin must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache origin in segment %s of logical volume %s.Could not read cache cleaner in segment %s of logical volume %s.Couldn't read cache metadata_format in segment %s of logical volume %s.Unknown cache metadata format %u number in segment %s of logical volume %s.Couldn't read metadata_start in segment %s of logical volume %s.Couldn't read metadata_len in segment %s of logical volume %s.Couldn't read data_start in segment %s of logical volume %s.Couldn't read data_len in segment %s of logical volume %s.Couldn't allocate metadata_id in segment %s of logical volume %s.Couldn't read metadata_id in segment %s of logical volume %s.Couldn't format metadata_id in segment %s of logical volume %s.Couldn't allocate data_id in segment %s of logical volume %s.Couldn't read data_id in segment %s of logical volume %s.Couldn't format data_id in segment %s of logical volume %s.Internal error: LV %s is using unknown cache metadada format %u.Cache data not specified in segment %s of logical volume %s.Cache data must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache data in segment %s of logical volume %s.Cache metadata not specified in segment %s of logical volume %s.Cache metadata must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache metadata in segment %s of logical volume %s.Failed to allocate memory for cache_pool segtypeFailed to allocate memory for cache segtype/proc/kallsymsglobal/cache_disabled_featurescacheInternal error: _destroy_config: cmd config tree not destroyed fullyInternal error: Unable to find configuration for log/%s.log/%s contains a value which is not a string. Ignoring.Unrecognised value for log/%s: %s_init_profiles: dm_strncpy failed_init_hostname: dm_pool_strdup failed_init_hostname: dm_pool_strdup kernel_vsn failed_set_tag: str_list_add %s failedInternal error: Unable to find configuration for devices/scan.Invalid string in config file: devices/scanNon standard udev dir %s, resetting devices/obtain_device_list_from_udev.Failed to add %s to internal device cacheWARNING: Metadata changes will NOT be backed upInternal error: Unable to find configuration for log/debug_classes.log/debug_classes contains a value which is not a string. Ignoring.Unrecognised value for log/debug_classes: %sSetting log debug classes to %dInvalid tag in config file: %sInvalid hostname string for tag %sLVM_SYSTEM_DIR or tag was too longconfig_tree_list allocation failedWARNING: Empty system ID supplied.WARNING: Failed to allocate system ID.WARNING: Invalid system ID format: %sWARNING: system ID may not begin with the string "localhost".WARNING: Ignoring extra line(s) in system ID file %s.aAbBcCdDeFGghHIjklmMpPrRsStTuUVwWxXyYzZ%Unrecognised configuration setting for global/units: %sConfigured time format is empty string.Configured time format contains non-printable characters.Invalid time format "%s" supplied.Device directory given in config file too longWARNING: unknown external device info source, using none.WARNING: failed to init udev for external device info, using none.WARNING: proc dir %s not found - some checks will be bypassedNo proc filesystem found: skipping sysfs detectionFailed to create /proc/mounts string for sysfs detectionFailed to find sysfs mount pointInvalid readahead specificationDM_DISABLE_UDEV environment variable set.Overriding configuration to use udev_rules=0, udev_sync=0, verify_udev_operations=1.manage logical volume symlinks in device directoryWARNING: activation/missing_stripe_filler = "%s" is invalid,Falling back to "error" missing_stripe_filler.WARNING: activation/missing_stripe_filler = "%s" is not a block device.Ignoring invalid activation/mlock_filter entry in config fileIgnoring too small pv_min_size %ldKB, using default %dKB.WARNING: local/system_id is set, so should global/system_id_source be "lvmlocal" not "%s"?WARNING: sd_id128_get_machine_app_specific() failed %s (%d).%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02xWARNING: Unrecognised system_id_source "%s".WARNING: No system ID found from system_id_source %s.Internal error: connections must be initialized before filtersFailed to create internal device filterFailed to create global regex device filterFailed to create regex device filterFailed to create lvm type filterFailed to create deviceid device filterFailed to create usabled device filterFailed to create partitioned device filterFailed to create signature device filterFailed to create persistent device filter.Duplicate segment type %s: unloading shared library %sLVM_SYSTEM_DIR environment variable is too long.Internal error: Unprocessed pending delete for %d devices.Failed to allocate command contextFailed to allocate line buffer.Failed to create LVM2 system dir for metadata backups, config files and internal cache.Set environment variable LVM_SYSTEM_DIR to alternative location or empty string.Library memory pool creation failedCommand memory pool creation failedcommands/toolcontext.cfilelinemessageprofile_params alloc failed_init_hostname%s%s%s failed: %sunameSetting host tag: %sFailed to create config tree/dev/archive_init failed.backup_init failed.debug_file_fieldsdebug_output_fieldsLogging initialised at %shost_listhost_filterhost_filter not supported yet%s/lvm%s%s.conflocalhostWARNING: %s: fopen failed: %sdeHImMSuUVwWycCxXyYSet umask from %04o to %04o%s/%s/mounts_get_sysfs_dir fopensysfsDM_DISABLE_UDEVLVM will %s./dev/ioerror stat failed: %sunknown devicelvmlocalappmachineid%s/machine-idLVM_ configuration invalid./run/lvm/lvmpolld.socketLVM_LVMPOLLD_SOCKETLVM_SYSTEM_DIRLVM_RUN_BY_DMEVENTDReloading config filessetlocale failedsetvbufD,!@T"@DEFAULT_SYS_DIR@/@DEFAULT_CACHE_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_BACKUP_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_ARCHIVE_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_PROFILE_SUBDIR@Internal error: _cfg_def_make_path: supplied buffer too small for %s/%sCouldn't create default backup path '%s/%s'.Couldn't create default archive path '%s/%s'.Couldn't create default profile path '%s/%s'.Internal error: Profile %s already added as %s type, but requested type is %s.Failed to create default empty array for %s._get_def_array_values: strdup failedFailed to create default config array value for %s.Failed to duplicate token for default array value of %s.Internal error: Default array value malformed for "%s", value: "%s", token: "%s".Internal error: inconsistent state reached in _check_value_differs_from_defaultFailed to create default config setting node.Failed to create default config setting node value.Internal error: _add_def_node: unknown type_log_array_value_used: failed to write node value%s not found in config: defaulting to %s_config_array_line: dm_pool_strdup failed_get_config_node_version: couldn't create version string%s# This configuration %s is deprecated. %s# This configuration %s is advanced. %s# This configuration %s is not officially supported. %s# This configuration %s has variable name. %s# This configuration %s does not have a default value defined. %s# This configuration %s has an automatic default value. %s# Value defined in existing configuration has been used for this setting. %s# Available since version %s. %s# Deprecated since version %s. Persistent cache directory name too long.WARNING: Configuration setting %s is disabled. Using default value.WARNING: Configuration setting "%s" has invalid type. Found%s but expected%s.Failed to construct path for configuration node %s.Configuration setting "%s" unknown.Configuration section "%s" unknown.Configuration setting "%s" invalid. Empty value not allowed.Configuration setting "%s" invalid. Found string value "%s", expected boolean value: 0/1, "y/n", "yes/no", "on/off", "true/false".Configuration setting "%s" invalid. It cannot be set to an empty value.Configuration %s "%s" is not customizable by a profile.Configuration %s "%s" is customizable by metadata profile only, not command profile.Configuration %s "%s" is customizable by command profile only, not metadata profile.Configuration %s "%s" is not allowed here.Internal error: couldn't determine missing config nodes - unknown status of last config check.Failed to create default config section node.Failed to allocate config source.Failed to allocate config file.Internal error: config_file_check: expected file, special file or profile config source, found %s config source.Internal error: config_file_changed: expected file config source, found %s config source.Config file %s has disappeared!Failed to reload configuration filesConfiguration file %s is not a regular fileDetected config file change to %sFailed to allocate configuration check handle.Internal error: config_file_read_fd: expected file, special file or profile config source, found %s config source.Failed to allocate circular buffer.WARNING: Metadata location on %s at offset %llu begins with invalid name.WARNING: Checksum error on %s at offset %llu.Internal error: %s cfg tree element not declared as boolean.# This is an example configuration file for the LVM2 system. # It contains the default settings that would be used if there was no # @DEFAULT_SYS_DIR@/lvm.conf file. # # Refer to 'man lvm.conf' for further information including the file layout. # # Refer to 'man lvm.conf' for information about how settings configured in # this file are combined with built-in values and command line options to # arrive at the final values used by LVM. # # Refer to 'man lvmconfig' for information about displaying the built-in # and configured values used by LVM. # # If a default value is set in this file (not commented out), then a # new version of LVM using this file will continue using that value, # even if the new version of LVM changes the built-in default value. # # To put this file in a different directory and override @DEFAULT_SYS_DIR@ set # the environment variable LVM_SYSTEM_DIR before running the tools. # # N.B. Take care that each setting only appears once if uncommenting # example settings in this file. # This is a local configuration file template for the LVM2 system # which should be installed as @DEFAULT_SYS_DIR@/lvmlocal.conf . # # Refer to 'man lvm.conf' for information about the file layout. # # To put this file in a different directory and override # @DEFAULT_SYS_DIR@ set the environment variable LVM_SYSTEM_DIR before # running the tools. # # The lvmlocal.conf file is normally expected to contain only the # "local" section which contains settings that should not be shared or # repeated among different hosts. (But if other sections are present, # they *will* get processed. Settings in this file override equivalent # ones in lvm.conf and are in turn overridden by ones in any enabled # lvm_.conf files.) # # Please take care that each setting only appears once if uncommenting # example settings in this file and never copy this file between hosts. Configuration node %s not foundFailed to create default config tree.Failed to create temporary config tree while creating full tree.Failed to clone current config tree.Failed to merge default and current config tree.Internal error: add_profile: incorrect configuration source, expected %s or %s but %s requested%s: bad profile name, it contains '/'.Internal error: add_profile: loaded profile has incorrect type, expected %s but %s foundInternal error: trying to load profile %s in critical section.LVM_SYSTEM_DIR or profile name too longInternal error: _override_config_tree_from_command_profile: config cascade already contains a command profile config.Internal error: _override_config_tree_from_metadata_profile: config cascade already contains a metadata profile config.Internal error: override_config_tree_from_profile: incorrect profile source typeInternal error: %s cfg tree element not declared as string.Internal error: %s cfg tree element not declared to allow empty values.Persistent cache filename too long.Internal error: %s cfg tree element not declared as integer.Internal error: %s cfg tree element not declared as float.Failed to create configuration definition hash.Failed to insert configuration to hash.Configuration setting "%s" invalid. It's not part of any section._check_profile: profile check handle allocation failedInternal error: override_config_tree_from_string: config cascade already contains a string config.Failed to set overridden configuration entries.Ignoring invalid configuration string.Internal error: %s cfg tree element not declared as array.Failed to create default array node for %s.WARNING: Configured cache_pool_max_chunks value %lu is higher then recommended %lu.How LVM configuration settings are handled. How LVM selects space and applies properties to LVs. How LVM log information is reported. How LVM metadata is backed up and archived. In LVM, a 'backup' is a copy of the metadata for the current system, and an 'archive' contains old metadata configurations. They are stored in a human readable text format. Settings for running LVM in shell (readline) mode. Miscellaneous global LVM settings. LVM report command output formatting. Settings for the LVM event daemon. LVM settings that are specific to the local host. If enabled, any LVM configuration mismatch is reported. This implies checking that the configuration key is understood by LVM and that the value of the key is the proper type. If disabled, any configuration mismatch is ignored and the default value is used without any warning (a message about the configuration key not being found is issued in verbose mode only). Abort the LVM process if a configuration mismatch is found. Directory where LVM looks for configuration profiles. Directory in which to create volume group device nodes. Commands also accept this as a prefix on volume group names. Directories containing device nodes to use with LVM. Obtain the list of available devices from udev. This avoids opening or using any inapplicable non-block devices or subdirectories found in the udev directory. Any device node or symlink not managed by udev in the udev directory is ignored. This setting applies only to the udev-managed device directory; other directories will be scanned fully. LVM needs to be compiled with udev support for this setting to apply. Enable device information from udev. If set to "udev", lvm will supplement its own native device information with information from libudev. This can potentially improve the detection of MD component devices and multipath component devices. Use a local file to remember which devices have PVs on them. Some commands will use this as an optimization to reduce device scanning, and will only scan the listed PVs. Removing the hint file will cause lvm to generate a new one. Disable hints if PVs will be copied onto devices using non-lvm commands, like dd. # Accepted values: all Use all hints. none Use no hints. # Select which path name to display for a block device. If multiple path names exist for a block device, and LVM needs to display a name for the device, the path names are matched against each item in this list of regular expressions. The first match is used. Try to avoid using undescriptive /dev/dm-N names, if present. If no preferred name matches, or if preferred_names are not defined, the following built-in preferences are applied in order until one produces a preferred name: Prefer names with path prefixes in the order of: /dev/mapper, /dev/disk, /dev/dm-*, /dev/block. Prefer the name with the least number of slashes. Prefer a name that is a symlink. Prefer the path with least value in lexicographical order. # Example preferred_names = [ "^/dev/mpath/", "^/dev/mapper/mpath", "^/dev/[hs]d" ] # Enable or disable the use of a devices file. When enabled, lvm will only use devices that are lised in the devices file. A devices file will be used, regardless of this setting, when the --devicesfile option is set to a specific file name. The name of the system devices file, listing devices that LVM should use. This should not be used to select a non-system devices file. The --devicesfile option is intended for alternative devices files. Look outside of the devices file for missing devname entries. A devname entry is used for a device that does not have a stable device id, e.g. wwid, so the unstable device name is used as the device id. After reboot, or if the device is reattached, the device name may change, in which case lvm will not find the expected PV on the device listed in the devices file. This setting controls whether lvm will search other devices, outside the devices file, to look for the missing PV on a renamed device. If "none", lvm will not look at other devices, and the PV may appear to be missing. If "auto", lvm will look at other devices, but only those that are likely to have the PV. If "all", lvm will look at all devices on the system. Limit the block devices that are used by LVM commands. This is a list of regular expressions used to accept or reject block device path names. Each regex is delimited by a vertical bar '|' (or any character) and is preceded by 'a' to accept the path, or by 'r' to reject the path. The first regex in the list to match the path is used, producing the 'a' or 'r' result for the device. When multiple path names exist for a block device, if any path name matches an 'a' pattern before an 'r' pattern, then the device is accepted. If all the path names match an 'r' pattern first, then the device is rejected. Unmatching path names do not affect the accept or reject decision. If no path names for a device match a pattern, then the device is accepted. Be careful mixing 'a' and 'r' patterns, as the combination might produce unexpected results (test changes.) Run vgscan after changing the filter to regenerate the cache. # Example Accept every block device: filter = [ "a|.*|" ] Reject the cdrom drive: filter = [ "r|/dev/cdrom|" ] Work with just loopback devices, e.g. for testing: filter = [ "a|loop|", "r|.*|" ] Accept all loop devices and ide drives except hdc: filter = [ "a|loop|", "r|/dev/hdc|", "a|/dev/ide|", "r|.*|" ] Use anchors to be very specific: filter = [ "a|^/dev/hda8$|", "r|.*|" ] # Limit the block devices that are used by LVM system components. Because devices/filter may be overridden from the command line, it is not suitable for system-wide device filtering, e.g. udev. Use global_filter to hide devices from these LVM system components. The syntax is the same as devices/filter. Devices rejected by global_filter are not opened by LVM. List of additional acceptable block device types. These are of device type names from /proc/devices, followed by the maximum number of partitions. # Example types = [ "fd", 16 ] # Restrict device scanning to block devices appearing in sysfs. This is a quick way of filtering out block devices that are not present on the system. sysfs must be part of the kernel and mounted.) Scan LVM LVs for layered PVs, allowing LVs to be used as PVs. When 1, LVM will detect PVs layered on LVs, and caution must be taken to avoid a host accessing a layered VG that may not belong to it, e.g. from a guest image. This generally requires excluding the LVs with device filters. Also, when this setting is enabled, every LVM command will scan every active LV on the system (unless filtered), which can cause performance problems on systems with many active LVs. When this setting is 0, LVM will not detect or use PVs that exist on LVs, and will not allow a PV to be created on an LV. The LVs are ignored using a built in device filter that identifies and excludes LVs. Ignore devices that are components of DM multipath devices. The path to the multipath wwids file used for multipath component detection. Set this to an empty string to disable the use of the multipath wwids file. Enable detection and exclusion of MD component devices. An MD component device is a block device that MD uses as part of a software RAID virtual device. When an LVM PV is created on an MD device, LVM must only use the top level MD device as the PV, and should ignore the underlying component devices. In cases where the MD superblock is located at the end of the component devices, it is more difficult for LVM to consistently identify an MD component, see the md_component_checks setting. The checks LVM should use to detect MD component devices. MD component devices are block devices used by MD software RAID. # Accepted values: auto LVM will skip scanning the end of devices when it has other indications that the device is not an MD component. start LVM will only scan the start of devices for MD superblocks. This does not incur extra I/O by LVM. full LVM will scan the start and end of devices for MD superblocks. This requires an extra read at the end of devices. # Ignore devices that are components of firmware RAID devices. LVM must use an external_device_info_source other than none for this detection to execute. Align the start of a PV data area with md device's stripe-width. This applies if a PV is placed directly on an md device. default_data_alignment will be overridden if it is not aligned with the value detected for this setting. This setting is overridden by data_alignment_detection, data_alignment, and the --dataalignment option. Align the start of a PV data area with this number of MiB. Set to 1 for 1MiB, 2 for 2MiB, etc. Set to 0 to disable. This setting is overridden by data_alignment and the --dataalignment option. Align the start of a PV data area with sysfs io properties. The start of a PV data area will be a multiple of minimum_io_size or optimal_io_size exposed in sysfs. minimum_io_size is the smallest request the device can perform without incurring a read-modify-write penalty, e.g. MD chunk size. optimal_io_size is the device's preferred unit of receiving I/O, e.g. MD stripe width. minimum_io_size is used if optimal_io_size is undefined (0). If md_chunk_alignment is enabled, that detects the optimal_io_size. default_data_alignment and md_chunk_alignment will be overridden if they are not aligned with the value detected for this setting. This setting is overridden by data_alignment and the --dataalignment option. Align the start of a PV data area with this number of KiB. When non-zero, this setting overrides default_data_alignment. Set to 0 to disable, in which case default_data_alignment is used to align the first PE in units of MiB. This setting is overridden by the --dataalignment option. data_alignment_offset_detectionShift the start of an aligned PV data area based on sysfs information. After a PV data area is aligned, it will be shifted by the alignment_offset exposed in sysfs. This offset is often 0, but may be non-zero. Certain 4KiB sector drives that compensate for windows partitioning will have an alignment_offset of 3584 bytes (sector 7 is the lowest aligned logical block, the 4KiB sectors start at LBA -1, and consequently sector 63 is aligned on a 4KiB boundary). This setting is overridden by the --dataalignmentoffset option. Ignore DM devices that have I/O suspended while scanning devices. Otherwise, LVM waits for a suspended device to become accessible. This should only be needed in recovery situations. Do not scan 'mirror' LVs to avoid possible deadlocks. This avoids possible deadlocks when using the 'mirror' segment type. This setting determines whether LVs using the 'mirror' segment type are scanned for LVM labels. This affects the ability of mirrors to be used as physical volumes. If this setting is enabled, it is impossible to create VGs on top of mirror LVs, i.e. to stack VGs on mirror LVs. If this setting is disabled, allowing mirror LVs to be scanned, it may cause LVM processes and I/O to the mirror to become blocked. This is due to the way that the mirror segment type handles failures. In order for the hang to occur, an LVM command must be run just after a failure and before the automatic LVM repair process takes place, or there must be failures in multiple mirrors in the same VG at the same time with write failures occurring moments before a scan of the mirror's labels. The 'mirror' scanning problems do not apply to LVM RAID types like 'raid1' which handle failures in a different way, making them a better choice for VG stacking. Allow use of pvcreate --uuid without requiring --restorefile. Minimum size in KiB of block devices which can be used as PVs. In a clustered environment all nodes must use the same value. Any value smaller than 512KiB is ignored. The previous built-in value was 512. Issue discards to PVs that are no longer used by an LV. Discards are sent to an LV's underlying physical volumes when the LV is no longer using the physical volumes' space, e.g. lvremove, lvreduce. Discards inform the storage that a region is no longer used. Storage that supports discards advertise the protocol-specific way discards should be issued by the kernel (TRIM, UNMAP, or WRITE SAME with UNMAP bit set). Not all storage will support or benefit from discards, but SSDs and thinly provisioned LUNs generally do. If enabled, discards will only be issued if both the storage and kernel provide support. allow_changes_with_duplicate_pvsAllow VG modification while a PV appears on multiple devices. When a PV appears on multiple devices, LVM attempts to choose the best device to use for the PV. If the devices represent the same underlying storage, the choice has minimal consequence. If the devices represent different underlying storage, the wrong choice can result in data loss if the VG is modified. Disabling this setting is the safest option because it prevents modifying a VG or activating LVs in it while a PV appears on multiple devices. Enabling this setting allows the VG to be used as usual even with uncertain devices. Allow PVs in the same VG with different logical block sizes. When allowed, the user is responsible to ensure that an LV is using PVs with matching block sizes when necessary. Advise LVM which PVs to use when searching for new space. When searching for free space to extend an LV, the 'cling' allocation policy will choose space on the same PVs as the last segment of the existing LV. If there is insufficient space and a list of tags is defined here, it will check whether any of them are attached to the PVs concerned and then seek to match those PV tags between existing extents and new extents. # Example Use the special tag "@*" as a wildcard to match any PV tag: cling_tag_list = [ "@*" ] LVs are mirrored between two sites within a single VG, and PVs are tagged with either @site1 or @site2 to indicate where they are situated: cling_tag_list = [ "@site1", "@site2" ] # Use a previous allocation algorithm. Changes made in version 2.02.85 extended the reach of the 'cling' policies to detect more situations where data can be grouped onto the same disks. This setting can be used to disable the changes and revert to the previous algorithm. Use blkid to detect and erase existing signatures on new PVs and LVs. The blkid library can detect more signatures than the native LVM detection code, but may take longer. LVM needs to be compiled with blkid wiping support for this setting to apply. LVM native detection code is currently able to recognize: MD device signatures, swap signature, and LUKS signatures. To see the list of signatures recognized by blkid, check the output of the 'blkid -k' command. wipe_signatures_when_zeroing_new_lvsLook for and erase any signatures while zeroing a new LV. The --wipesignatures option overrides this setting. Zeroing is controlled by the -Z/--zero option, and if not specified, zeroing is used by default if possible. Zeroing simply overwrites the first 4KiB of a new LV with zeroes and does no signature detection or wiping. Signature wiping goes beyond zeroing and detects exact types and positions of signatures within the whole LV. It provides a cleaner LV after creation as all known signatures are wiped. The LV is not claimed incorrectly by other tools because of old signatures from previous use. The number of signatures that LVM can detect depends on the detection code that is selected (see use_blkid_wiping.) Wiping each detected signature must be confirmed. When this setting is disabled, signatures on new LVs are not detected or erased unless the --wipesignatures option is used directly. mirror_logs_require_separate_pvsMirror logs and images will always use different PVs. The default setting changed in version 2.02.85. Stripe across all PVs when RAID stripes are not specified. If enabled, all PVs in the VG or on the command line are used for raid0/4/5/6/10 when the command does not specify the number of stripes to use. This was the default behaviour until release 2.02.162. cache_pool_metadata_require_separate_pvsCache pool metadata and data will always use different PVs. This has been replaced by the allocation/cache_mode setting. Sets default metadata format for new cache. # Accepted values: 0 Automatically detected best available format 1 Original format 2 Improved 2nd. generation format # The default cache mode used for new cache. # Accepted values: writethrough Data blocks are immediately written from the cache to disk. writeback Data blocks are written from the cache back to disk after some delay to improve performance. # This setting replaces allocation/cache_pool_cachemode. The default cache policy used for new cache volume. Since kernel 4.2 the default policy is smq (Stochastic multiqueue), otherwise the older mq (Multiqueue) policy is selected. Settings for the cache policy. See documentation for individual cache policies for more info. Replace this subsection name with a policy name. Multiple subsections for different policies can be created. The minimal chunk size in KiB for cache pool volumes. Using a chunk_size that is too large can result in wasteful use of the cache, where small reads and writes can cause large sections of an LV to be mapped into the cache. However, choosing a chunk_size that is too small can result in more overhead trying to manage the numerous chunks that become mapped into the cache. The former is more of a problem than the latter in most cases, so the default is on the smaller end of the spectrum. Supported values range from 32KiB to 1GiB in multiples of 32. The maximum number of chunks in a cache pool. For cache target v1.9 the recommended maximumm is 1000000 chunks. Using cache pool with more chunks may degrade cache performance. thin_pool_metadata_require_separate_pvsThin pool metadata and data will always use different PVs. Older version of lvm2 cropped pool's metadata size to 15.81 GiB. This is slightly less then the actual maximum 15.88 GiB. For compatibility with older version and use of cropped size set to 1. Thin pool data chunks are zeroed before they are first used. Zeroing with a larger thin pool chunk size reduces performance. The discards behaviour of thin pool volumes. # Accepted values: ignore nopassdown passdown # The chunk size calculation policy for thin pool volumes. # Accepted values: generic If thin_pool_chunk_size is defined, use it. Otherwise, calculate the chunk size based on estimation and device hints exposed in sysfs - the minimum_io_size. The chunk size is always at least 64KiB. performance If thin_pool_chunk_size is defined, use it. Otherwise, calculate the chunk size for performance based on device hints exposed in sysfs - the optimal_io_size. The chunk size is always at least 512KiB. # Zero whole metadata area before use with thin or cache pool. The minimal chunk size in KiB for thin pool volumes. Larger chunk sizes may improve performance for plain thin volumes, however using them for snapshot volumes is less efficient, as it consumes more space and takes extra time for copying. When unset, lvm tries to estimate chunk size starting from 64KiB. Supported values are in the range 64KiB to 1GiB. Default physical extent size in KiB to use for new VGs. Enables or disables compression when creating a VDO volume. Compression may be disabled if necessary to maximize performance or to speed processing of data that is unlikely to compress. Enables or disables deduplication when creating a VDO volume. Deduplication may be disabled in instances where data is not expected to have good deduplication rates but compression is still desired. Enables or disables whether VDO volume should tag its latency-critical writes with the REQ_SYNC flag. Some device mapper targets such as dm-raid5 process writes with this flag at a higher priority. The minimum IO size for VDO volume to accept, in bytes. Valid values are 512 or 4096. The recommended value is 4096. Specifies the amount of memory in MiB allocated for caching block map pages for VDO volume. The value must be a multiple of 4096 and must be at least 128MiB and less than 16TiB. The cache must be at least 16MiB per logical thread. Note that there is a memory overhead of 15%. The speed with which the block map cache writes out modified block map pages. A smaller era length is likely to reduce the amount time spent rebuilding, at the cost of increased block map writes during normal operation. The maximum and recommended value is 16380; the minimum value is 1. The default check point frequency for VDO volume. Enables sparse indexing for VDO volume. Specifies the amount of index memory in MiB for VDO volume. The value must be at least 256MiB and at most 1TiB. Specifies the size in MiB of the increment by which a VDO is grown. Using a smaller size constrains the total maximum physical size that can be accommodated. Must be a power of two between 128MiB and 32GiB. Specifies the number of threads to use for acknowledging completion of requested VDO I/O operations. The value must be at in range [0..100]. Specifies the number of threads to use for submitting I/O operations to the storage device of VDO volume. The value must be in range [1..100]. Each additional thread after the first will use an additional 18MiB of RAM, plus 1.12 MiB of RAM per megabyte of configured read cache size. Specifies the number of I/O operations to enqueue for each bio-submission thread before directing work to the next. The value must be in range [1..1024]. Specifies the number of threads to use for CPU-intensive work such as hashing or compression for VDO volume. The value must be in range [1..100]. Specifies the number of threads across which to subdivide parts of the VDO processing based on the hash value computed from the block data. The value must be at in range [0..100]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Specifies the number of threads across which to subdivide parts of the VDO processing based on the hash value computed from the block data. A logical thread count of 9 or more will require explicitly specifying a sufficiently large block map cache size, as well. The value must be in range [0..60]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Specifies the number of threads across which to subdivide parts of the VDO processing based on physical block addresses. Each additional thread after the first will use an additional 10MiB of RAM. The value must be in range [0..16]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Specifies the write policy: auto - VDO will check the storage device and determine whether it supports flushes. If it does, VDO will run in async mode, otherwise it will run in sync mode. sync - Writes are acknowledged only after data is stably written. This policy is not supported if the underlying storage is not also synchronous. async - Writes are acknowledged after data has been cached for writing to stable storage. Data which has not been flushed is not guaranteed to persist in this mode. async-unsafe - Writes are handled like 'async' but there is no guarantee of the atomicity async provides. This mode should only be used for better performance when atomicity is not required. Specified the maximum size of discard bio accepted, in 4096 byte blocks. I/O requests to a VDO volume are normally split into 4096-byte blocks, and processed up to 2048 at a time. However, discard requests to a VDO volume can be automatically split to a larger size, up to 4096-byte blocks in a single bio, and are limited to 1500 at a time. Increasing this value may provide better overall performance, at the cost of increased latency for the individual discard requests. The default and minimum is 1. The maximum is UINT_MAX / 4096. Specified the emptry header size in KiB at the front and end of vdo pool device. Enable or disable LVM log reporting. If enabled, LVM will collect a log of operations, messages, per-object return codes with object identification and associated error numbers (errnos) during LVM command processing. Then the log is either reported solely or in addition to any existing reports, depending on LVM command used. If it is a reporting command (e.g. pvs, vgs, lvs, lvm fullreport), then the log is reported in addition to any existing reports. Otherwise, there's only log report on output. For all applicable LVM commands, you can request that the output has only log report by using --logonly command line option. Use log/command_log_cols and log/command_log_sort settings to define fields to display and sort fields for the log report. You can also use log/command_log_selection to define selection criteria used each time the log is reported. List of columns to sort by when reporting command log. See --logonly --configreport log -o help for the list of possible fields. log_seq_num,log_type,log_context,log_object_type,log_object_name,log_object_id,log_object_group,log_object_group_id,log_message,log_errno,log_ret_codeList of columns to report when reporting command log. See --logonly --configreport log -o help for the list of possible fields. !(log_type=status && message=success)Selection criteria used when reporting command log. You can define selection criteria that are applied each time log is reported. This way, it is possible to control the amount of log that is displayed on output and you can select only parts of the log that are important for you. To define selection criteria, use fields from log report. See also --logonly --configreport log -S help for the list of possible fields and selection operators. You can also define selection criteria for log report on command line directly using --configreport log -S which has precedence over log/command_log_selection setting. For more information about selection criteria in general, see lvm(8) man page. Controls the messages sent to stdout or stderr. Suppress all non-essential messages from stdout. This has the same effect as -qq. When enabled, the following commands still produce output: dumpconfig, lvdisplay, lvmdiskscan, lvs, pvck, pvdisplay, pvs, version, vgcfgrestore -l, vgdisplay, vgs. Non-essential messages are shifted from log level 4 to log level 5 for syslog and lvm2_log_fn purposes. Any 'yes' or 'no' questions not overridden by other arguments are suppressed and default to 'no'. Send log messages through syslog. Write error and debug log messages to a file specified here. Record lvm information in the systemd journal. command: record commands that are run. output: record default output from commands. debug: record debug messages from commands. Overwrite the log file each time the program is run. The level of log messages that are sent to the log file or syslog. There are 6 syslog-like log levels currently in use: 2 to 7 inclusive. 7 is the most verbose (LOG_DEBUG). Indent messages according to their severity. Display the command name on each line of output. A prefix to use before the log message text. (After the command name, if selected). Two spaces allows you to see/grep the severity of each message. To make the messages look similar to the original LVM tools use: indent = 0, command_names = 1, prefix = " -- " Log messages during activation. Don't use this in low memory situations (can deadlock). #Smemory#Sdevices#Sio#Sactivation#Sallocation#Smetadata#Scache#Slocking#Slvmpolld#SdbusSelect log messages by class. Some debugging messages are assigned to a class and only appear in debug output if the class is listed here. Classes currently available: memory, devices, io, activation, allocation, metadata, cache, locking, lvmpolld. Use "all" to see everything. #Stime#Scommand#Sfileline#SmessageThe fields included in debug output written to log file. Use "all" to include everything (the default). The fields included in debug output written to stderr. Use "all" to include everything (the default). Maintain a backup of the current metadata configuration. Think very hard before turning this off! Location of the metadata backup files. Remember to back up this directory regularly! Maintain an archive of old metadata configurations. Think very hard before turning this off. Location of the metdata archive files. Remember to back up this directory regularly! Minimum number of archives to keep. Minimum number of days to keep archive files. Number of lines of history to store in ~/.lvm_history. The file creation mask for any files and directories created. Interpreted as octal if the first digit is zero. No on-disk metadata changes will be made in test mode. Equivalent to having the -t option on every command. Default value for --units argument. Distinguish between powers of 1024 and 1000 bytes. The LVM commands distinguish between powers of 1024 bytes, e.g. KiB, MiB, GiB, and powers of 1000 bytes, e.g. KB, MB, GB. If scripts depend on the old behaviour, disable this setting temporarily until they are updated. Display unit suffix for sizes. This setting has no effect if the units are in human-readable form (global/units = "h") in which case the suffix is always displayed. Enable/disable communication with the kernel device-mapper. Disable to use the tools to manipulate LVM metadata without activating any logical volumes. If the device-mapper driver is not present in the kernel, disabling this should suppress the error messages. Location of /etc system configuration directory. When disabled, fail if a lock request would block. Directory to use for LVM command file locks. Local non-LV directory that holds file-based locks while commands are in progress. A directory like /tmp that may get wiped on reboot is OK. Allow quicker VG write access during high volume read access. When there are competing read-only and read-write access requests for a volume group's metadata, instead of always granting the read-only requests immediately, delay them to allow the read-write requests to be serviced. Without this setting, write access may be stalled by a high volume of read-only requests. This option only affects file locks. Search this directory first for shared libraries. Abort a command that encounters an internal error. Treat any internal errors as fatal errors, aborting the process that encountered the internal error. Please only enable for debugging. detect_internal_vg_cache_corruptionNo operations that change on-disk metadata are permitted. Additionally, read-only commands that encounter metadata in need of repair will still be allowed to proceed exactly as if the repair had been performed (except for the unchanged vg_seqno). Inappropriate use could mess up your system, so seek advice first! The segment type used by the short mirroring option -m. The --type mirror|raid1 option overrides this setting. # Accepted values: mirror The original RAID1 implementation from LVM/DM. It is characterized by a flexible log solution (core, disk, mirrored), and by the necessity to block I/O while handling a failure. There is an inherent race in the dmeventd failure handling logic with snapshots of devices using this type of RAID1 that in the worst case could cause a deadlock. (Also see devices/ignore_lvm_mirrors.) raid1 This is a newer RAID1 implementation using the MD RAID1 personality through device-mapper. It is characterized by a lack of log options. (A log is always allocated for every device and they are placed on the same device as the image, so no separate devices are required.) This mirror implementation does not require I/O to be blocked while handling a failure. This mirror implementation is not cluster-aware and cannot be used in a shared (active/active) fashion in a cluster. # Enable mirrored 'mirror' log type for testing. # This type is deprecated to create or convert to but can be enabled to test that activation of existing mirrored logs and conversion to disk/core works. # Not supported for regular operation! The segment type used by the -i -m combination. The --type raid10|mirror option overrides this setting. The --stripes/-i and --mirrors/-m options can both be specified during the creation of a logical volume to use both striping and mirroring for the LV. There are two different implementations. # Accepted values: raid10 LVM uses MD's RAID10 personality through DM. This is the preferred option. mirror LVM layers the 'mirror' and 'stripe' segment types. The layering is done by creating a mirror LV on top of striped sub-LVs, effectively creating a RAID 0+1 array. The layering is suboptimal in terms of providing redundancy and performance. # The segment type used by the -V -L combination. The --type snapshot|thin option overrides this setting. The combination of -V and -L options creates a sparse LV. There are two different implementations. # Accepted values: snapshot The original snapshot implementation from LVM/DM. It uses an old snapshot that mixes data and metadata within a single COW storage volume and performs poorly when the size of stored data passes hundreds of MB. thin A newer implementation that uses thin provisioning. It has a bigger minimal chunk size (64KiB) and uses a separate volume for metadata. It has better performance, especially when more data is used. It also supports full snapshots. # lvdisplay_shows_full_device_pathEnable this to reinstate the previous lvdisplay name format. The default format for displaying LV names in lvdisplay was changed in version 2.02.89 to show the LV name and path separately. Previously this was always shown as /dev/vgname/lvname even when that was never a valid path in the /dev filesystem. Activate LVs based on system-generated device events. When a PV appears on the system, a system-generated uevent triggers the lvm2-pvscan service which runs the pvscan --cache -aay command. If the new PV completes a VG, pvscan autoactivates LVs in the VG. When event_activation is disabled, the lvm2-activation services are generated and run at fixed points during system startup. These services run vgchange -aay to autoactivate LVs in VGs that happen to be present at that point in time. See the --setautoactivation option or the auto_activation_volume_list setting to configure autoactivation for specific VGs or LVs. Use async I/O when reading and writing devices. Use lvmlockd for locking among hosts using LVM on shared storage. Applicable only if LVM is compiled with lockd support in which case there is also lvmlockd(8) man page available for more information. Retry lvmlockd lock requests this many times. Applicable only if LVM is compiled with lockd support Size in MiB to extend the internal LV holding sanlock locks. The internal LV holds locks for each LV in the VG, and after enough LVs have been created, the internal LV needs to be extended. lvcreate will automatically extend the internal LV when needed by the amount specified here. Setting this to 0 disables the automatic extension and can cause lvcreate to fail. Applicable only if LVM is compiled with lockd support The command that lvmlockctl --kill should use to force LVs offline. The lvmlockctl --kill command is run when a shared VG has lost access to locks (e.g. when sanlock has lost access to storage.) An empty string means that there will be no automatic attempt by lvmlockctl --kill to forcibly shut down LVs in the VG, and the user can manually intervene as described in lvmlockd(8). The VG name will be appended to the command specified here. The full path to the thin_check command. LVM uses this command to check that a thin metadata device is in a usable state. When a thin pool is activated and after it is deactivated, this command is run. Activation will only proceed if the command has an exit status of 0. Set to "" to skip this check. (Not recommended.) Also see thin_check_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the thin_dump command. LVM uses this command to dump thin pool metadata. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the thin_repair command. LVM uses this command to repair a thin metadata device if it is in an unusable state. Also see thin_repair_options. (See package device-mapper-persistent-data or thin-provisioning-tools) #S-q#S--clear-needs-check-flagList of options passed to the thin_check command. With thin_check version 2.1 or newer you can add the option --ignore-non-fatal-errors to let it pass through ignorable errors and fix them later. With thin_check version 3.2 or newer you should include the option --clear-needs-check-flag. List of options passed to the thin_repair command. Features to not use in the thin driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: block_size, discards, discards_non_power_2, external_origin, metadata_resize, external_origin_extend, error_if_no_space. # Example thin_disabled_features = [ "discards", "block_size" ] # Features to not use in the cache driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: policy_mq, policy_smq, metadata2. # Example cache_disabled_features = [ "policy_smq" ] # The full path to the cache_check command. LVM uses this command to check that a cache metadata device is in a usable state. When a cached LV is activated and after it is deactivated, this command is run. Activation will only proceed if the command has an exit status of 0. Set to "" to skip this check. (Not recommended.) Also see cache_check_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the cache_dump command. LVM uses this command to dump cache pool metadata. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the cache_repair command. LVM uses this command to repair a cache metadata device if it is in an unusable state. Also see cache_repair_options. (See package device-mapper-persistent-data or thin-provisioning-tools) List of options passed to the cache_check command. With cache_check version 5.0 or newer you should include the option --clear-needs-check-flag. List of options passed to the cache_repair command. The full path to the vdoformat command. LVM uses this command to initial data volume for VDO type logical volume List of options passed added to standard vdoformat command. Features to not use in the vdo driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: online_rename # Example vdo_disabled_features = [ "online_rename" ] # The full path to the fsadm command. LVM uses this command to help with lvresize -r operations. The method LVM uses to set the local system ID. Volume Groups can also be given a system ID (by vgcreate, vgchange, or vgimport.) A VG on shared storage devices is accessible only to the host with a matching system ID. See 'man lvmsystemid' for information on limitations and correct usage. # Accepted values: none The host has no system ID. lvmlocal Obtain the system ID from the system_id setting in the 'local' section of an lvm configuration file, e.g. lvmlocal.conf. uname Set the system ID from the hostname (uname) of the system. System IDs beginning localhost are not permitted. appmachineid Use an LVM-specific derivation of the local machine-id as the system ID. See 'man machine-id'. machineid Use the contents of the machine-id file to set the system ID (appmachineid is recommended.) file Use the contents of another file (system_id_file) to set the system ID. # The full path to the file containing a system ID. This is used when system_id_source is set to 'file'. Comments starting with the character # are ignored. Perform internal checks of libdevmapper operations. Useful for debugging problems with activation. Some of the checks may be expensive, so it's best to use this only when there seems to be a problem. Use lvmpolld to supervise long running LVM commands. When enabled, control of long running LVM commands is transferred from the original LVM command to the lvmpolld daemon. This allows the operation to continue independent of the original LVM command. After lvmpolld takes over, the LVM command displays the progress of the ongoing operation. lvmpolld itself runs LVM commands to manage the progress of ongoing operations. lvmpolld can be used as a native systemd service, which allows it to be started on demand, and to use its own control group. When this option is disabled, LVM commands will supervise long running operations by forking themselves. Applicable only if LVM is compiled with lvmpolld support. Enable D-Bus notification from LVM commands. When enabled, an LVM command that changes PVs, changes VG metadata, or changes the activation state of an LV will send a notification. The amount of memory in KiB that LVM allocates to perform disk io. LVM performance may benefit from more io memory when there are many disks or VG metadata is large. Increasing this size may be necessary when a single copy of VG metadata is larger than the current setting. This value should usually not be decreased from the default; setting it too low can result in lvm failing to read VGs. Use udev notifications to synchronize udev and LVM. The --noudevsync option overrides this setting. When disabled, LVM commands will not wait for notifications from udev, but continue irrespective of any possible udev processing in the background. Only use this if udev is not running or has rules that ignore the devices LVM creates. If enabled when udev is not running, and LVM processes are waiting for udev, run the command 'dmsetup udevcomplete_all' to wake them up. Use udev rules to manage LV device nodes and symlinks. When disabled, LVM will manage the device nodes and symlinks for active LVs itself. Manual intervention may be required if this setting is changed while LVs are active. Use extra checks in LVM to verify udev operations. This enables additional checks (and if necessary, repairs) on entries in the device directory after udev has completed processing its events. Useful for diagnosing problems with LVM/udev interactions. Retry failed LV deactivation. If LV deactivation fails, LVM will retry for a few seconds before failing. This may happen because a process run from a quick udev rule temporarily opened the device. Method to fill missing stripes when activating an incomplete LV. Using 'error' will make inaccessible parts of the device return I/O errors on access. Using 'zero' will return success (and zero) on I/O You can instead use a device path, in which case, that device will be used in place of missing stripes. Using anything other than 'error' with mirrored or snapshotted volumes is likely to result in data corruption. Use the linear target to optimize single stripe LVs. When disabled, the striped target is used. The linear target is an optimised version of the striped target that only handles a single stripe. Stack size in KiB to reserve for use while devices are suspended. Insufficent reserve risks I/O deadlock during device suspension. Memory size in KiB to reserve for use while devices are suspended. Insufficent reserve risks I/O deadlock during device suspension. Nice value used while devices are suspended. Use a high priority so that LVs are suspended for the shortest possible time. Only LVs selected by this list are activated. If this list is defined, an LV is only activated if it matches an entry in this list. If this list is undefined, it imposes no limits on LV activation (all are allowed). # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # A list of VGs or LVs that should be autoactivated. Autoactivation is an activation command run with -aay, i.e. vgchange -aay, lvchange -aay, or pvscan --cache -aay. When this list is defined, an autoactivation command will only activate LVs included in the list. If this list is undefined, it has no effect. If this list is defined but empty, then no LVs will be autoactivated. LVs can be included in the list by LV name, VG name (applies to all LVs in the VG), or tag name. VGs and LVs can also have an autoactivation property set in metadata, see --setautoactivation. LVs included in this list will not be autoactivated if the VG or LV autoactivation property is disabled (see vgs or lvs "-o autoactivation"). The volume_list setting and the "activation skip" property also apply to autoactivation. The -aay option is meant to be used by activation commands that are run automatically by the system, e.g. from systemd services. # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example auto_activation_volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # LVs in this list are activated in read-only mode. If this list is defined, each LV that is to be activated is checked against this list, and if it matches, it is activated in read-only mode. This overrides the permission setting stored in the metadata, e.g. from --permission rw. # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example read_only_volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # This has been replaced by the activation/raid_region_size setting. Size in KiB of each raid or mirror synchronization region. Size in KiB of each raid or mirror synchronization region. The clean/dirty state of data is tracked for each region. The value is rounded down to a power of two if necessary, and is ignored if it is not a multiple of the machine memory page size. Return errors if a thin pool runs out of space. The --errorwhenfull option overrides this setting. When enabled, writes to thin LVs immediately return an error if the thin pool is out of data space. When disabled, writes to thin LVs are queued if the thin pool is out of space, and processed when the thin pool data space is extended. New thin pools are assigned the behavior defined here. Setting to use when there is no readahead setting in metadata. # Accepted values: none Disable readahead. auto Use default value chosen by kernel. # Defines how a device failure in a RAID LV is handled. This includes LVs that have the following segment types: raid1, raid4, raid5*, and raid6*. If a device in the LV fails, the policy determines the steps performed by dmeventd automatically, and the steps perfomed by the manual command lvconvert --repair --use-policies. Automatic handling requires dmeventd to be monitoring the LV. # Accepted values: warn Use the system log to warn the user that a device in the RAID LV has failed. It is left to the user to run lvconvert --repair manually to remove or replace the failed device. As long as the number of failed devices does not exceed the redundancy of the LV (1 device for raid4/5, 2 for raid6), the LV will remain usable. allocate Attempt to use any extra physical volumes in the VG as spares and replace faulty devices. # Defines how a device failure in a 'mirror' LV is handled. An LV with the 'mirror' segment type is composed of mirror images (copies) and a mirror log. A disk log ensures that a mirror LV does not need to be re-synced (all copies made the same) every time a machine reboots or crashes. If a device in the LV fails, this policy determines the steps perfomed by dmeventd automatically, and the steps performed by the manual command lvconvert --repair --use-policies. Automatic handling requires dmeventd to be monitoring the LV. # Accepted values: remove Simply remove the faulty device and run without it. If the log device fails, the mirror would convert to using an in-memory log. This means the mirror will not remember its sync status across crashes/reboots and the entire mirror will be re-synced. If a mirror image fails, the mirror will convert to a non-mirrored device if there is only one remaining good copy. allocate Remove the faulty device and try to allocate space on a new device to be a replacement for the failed device. Using this policy for the log is fast and maintains the ability to remember sync state through crashes/reboots. Using this policy for a mirror device is slow, as it requires the mirror to resynchronize the devices, but it will preserve the mirror characteristic of the device. This policy acts like 'remove' if no suitable device and space can be allocated for the replacement. allocate_anywhere Not yet implemented. Useful to place the log device temporarily on the same physical volume as one of the mirror images. This policy is not recommended for mirror devices since it would break the redundant nature of the mirror. This policy acts like 'remove' if no suitable device and space can be allocated for the replacement. # Defines how a device failure in a 'mirror' log LV is handled. The mirror_image_fault_policy description for mirrored LVs also applies to mirrored log LVs. This has been replaced by the activation/mirror_image_fault_policy setting. Define how a device failure affecting a mirror is handled. Auto-extend a snapshot when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see snapshot_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G snapshot exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: snapshot_autoextend_threshold = 70 # Auto-extending a snapshot adds this percent extra space. The amount of additional space added to a snapshot is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G snapshot exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: snapshot_autoextend_percent = 20 # thin_pool_autoextend_thresholdAuto-extend a thin pool when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see thin_pool_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G thin pool exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: thin_pool_autoextend_threshold = 70 # Auto-extending a thin pool adds this percent extra space. The amount of additional space added to a thin pool is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G thin pool exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: thin_pool_autoextend_percent = 20 # Auto-extend a VDO pool when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see vdo_pool_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 10G VDO pool exceeds 7G, it is extended to 12G, and when it exceeds 8.4G, it is extended to 14.4G: vdo_pool_autoextend_threshold = 70 # Auto-extending a VDO pool adds this percent extra space. The amount of additional space added to a VDO pool is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 10G VDO pool exceeds 7G, it is extended to 12G, and when it exceeds 8.4G, it is extended to 14.4G: Do not mlock these memory areas. While activating devices, I/O to devices being (re)configured is suspended. As a precaution against deadlocks, LVM pins memory it is using so it is not paged out, and will not require I/O to reread. Groups of pages that are known not to be accessed during activation do not need to be pinned into memory. Each string listed in this setting is compared against each line in /proc/self/maps, and the pages corresponding to lines that match are not pinned. On some systems, locale-archive was found to make up over 80% of the memory used by the process. # Example mlock_filter = [ "locale/locale-archive", "gconv/gconv-modules.cache" ] # Use the old behavior of mlockall to pin all memory. Prior to version 2.02.62, LVM used mlockall() to pin the whole process's memory while activating devices. Monitor LVs that are activated. The --ignoremonitoring option overrides this setting. When enabled, LVM will ask dmeventd to monitor activated LVs. Check pvmove or lvconvert progress at this interval (seconds). When pvmove or lvconvert must wait for the kernel to finish synchronising or merging data, they check and report progress at intervals of this number of seconds. If this is set to 0 and there is only one thing to wait for, there are no progress reports, but the process is awoken immediately once the operation is complete. Set the activation skip flag on new thin snapshot LVs. The --setactivationskip option overrides this setting. An LV can have a persistent 'activation skip' flag. The flag causes the LV to be skipped during normal activation. The lvchange/vgchange -K option is required to activate LVs that have the activation skip flag set. When this setting is enabled, the activation skip flag is set on new thin snapshot LVs. How LVs with missing devices are activated. The --activationmode option overrides this setting. # Accepted values: complete Only allow activation of an LV if all of the Physical Volumes it uses are present. Other PVs in the Volume Group may be missing. degraded Like complete, but additionally RAID LVs of segment type raid1, raid4, raid5, radid6 and raid10 will be activated if there is no data loss, i.e. they have sufficient redundancy to present the entire addressable range of the Logical Volume. partial Allows the activation of any LV even if a missing or failed PV could cause data loss with a portion of the LV inaccessible. This setting should not normally be used, but may sometimes assist with data recovery. # Locking is started only for VGs selected by this list. The rules are the same as those for volume_list. Locking is auto-started only for VGs selected by this list. The rules are the same as those for auto_activation_volume_list. Check device sizes are not smaller than corresponding PV sizes. If device size is less than corresponding PV size found in metadata, there is always a risk of data loss. If this option is set, then LVM issues a warning message each time it finds that the device size is less than corresponding PV size. You should not disable this unless you are absolutely sure about what you are doing! When enabled, LVM keeps history records about removed LVs in metadata. The information that is recorded in metadata for historical LVs is reduced when compared to original information kept in metadata for live LVs. Currently, this feature is supported for thin and thin snapshot LVs only. Retention time in seconds after which a record about individual historical logical volume is automatically destroyed. A value of 0 disables this feature. Number of copies of metadata to store on each PV. The --pvmetadatacopies option overrides this setting. # Accepted values: 2 Two copies of the VG metadata are stored on the PV, one at the front of the PV, and one at the end. 1 One copy of VG metadata is stored at the front of the PV. 0 No copies of VG metadata are stored on the PV. This may be useful for VGs containing large numbers of PVs. # Number of copies of metadata to maintain for each VG. The --vgmetadatacopies option overrides this setting. If set to a non-zero value, LVM automatically chooses which of the available metadata areas to use to achieve the requested number of copies of the VG metadata. If you set a value larger than the the total number of metadata areas available, then metadata is stored in them all. The value 0 (unmanaged) disables this automatic management and allows you to control which metadata areas are used at the individual PV level using pvchange --metadataignore y|n. The default size of the metadata area in units of 512 byte sectors. The metadata area begins at an offset of the page size from the start of the device. The first PE is by default at 1 MiB from the start of the device. The space between these is the default metadata area size. The actual size of the metadata area may be larger than what is set here due to default_data_alignment making the first PE a MiB multiple. The metadata area begins with a 512 byte header and is followed by a circular buffer used for VG metadata text. The maximum size of the VG metadata is about half the size of the metadata buffer. VGs with large numbers of PVs or LVs, or VGs containing complex LV structures, may need additional space for VG metadata. The --metadatasize option overrides this setting. Ignore metadata areas on a new PV. The --metadataignore option overrides this setting. If metadata areas on a PV are ignored, LVM will not store metadata in them. Format of LVM command's report output. If there is more than one report per command, then the format is applied for all reports. You can also change output format directly on command line using --reportformat option which has precedence over log/output_format setting. Accepted values: basic Original format with columns and rows. If there is more than one report per command, each report is prefixed with report's name for identification. json JSON format. Do not print empty values for all report fields. If enabled, all fields that don't have a value set for any of the rows reported are skipped and not printed. Compact output is applicable only if report/buffered is enabled. If you need to compact only specified fields, use compact_output=0 and define report/compact_output_cols configuration setting instead. Do not print empty values for specified report fields. If defined, specified fields that don't have a value set for any of the rows reported are skipped and not printed. Compact output is applicable only if report/buffered is enabled. If you need to compact all fields, use compact_output=1 instead in which case the compact_output_cols setting is then ignored. Align columns in report output. Buffer report output. When buffered reporting is used, the report's content is appended incrementally to include each object being reported until the report is flushed to output which normally happens at the end of command execution. Otherwise, if buffering is not used, each object is reported as soon as its processing is finished. Show headings for columns on report. A separator to use on report after each field. A separator to use for list items when reported. Use a field name prefix for each field reported. Quote field values when using field name prefixes. Output each column as a row. If set, this also implies report/prefixes=1. Use binary values 0 or 1 instead of descriptive literal values. For columns that have exactly two valid values to report (not counting the 'unknown' value which denotes that the value could not be determined). Set time format for fields reporting time values. Format specification is a string which may contain special character sequences and ordinary character sequences. Ordinary character sequences are copied verbatim. Each special character sequence is introduced by the '%' character and such sequence is then substituted with a value as described below. # Accepted values: %a The abbreviated name of the day of the week according to the current locale. %A The full name of the day of the week according to the current locale. %b The abbreviated month name according to the current locale. %B The full month name according to the current locale. %c The preferred date and time representation for the current locale (alt E) %C The century number (year/100) as a 2-digit integer. (alt E) %d The day of the month as a decimal number (range 01 to 31). (alt O) %D Equivalent to %m/%d/%y. (For Americans only. Americans should note that in other countries%d/%m/%y is rather common. This means that in international context this format is ambiguous and should not be used. %e Like %d, the day of the month as a decimal number, but a leading zero is replaced by a space. (alt O) %E Modifier: use alternative local-dependent representation if available. %F Equivalent to %Y-%m-%d (the ISO 8601 date format). %G The ISO 8601 week-based year with century as adecimal number. The 4-digit year corresponding to the ISO week number (see %V). This has the same format and value as %Y, except that if the ISO week number belongs to the previous or next year, that year is used instead. %g Like %G, but without century, that is, with a 2-digit year (00-99). %h Equivalent to %b. %H The hour as a decimal number using a 24-hour clock (range 00 to 23). (alt O) %I The hour as a decimal number using a 12-hour clock (range 01 to 12). (alt O) %j The day of the year as a decimal number (range 001 to 366). %k The hour (24-hour clock) as a decimal number (range 0 to 23); single digits are preceded by a blank. (See also %H.) %l The hour (12-hour clock) as a decimal number (range 1 to 12); single digits are preceded by a blank. (See also %I.) %m The month as a decimal number (range 01 to 12). (alt O) %M The minute as a decimal number (range 00 to 59). (alt O) %O Modifier: use alternative numeric symbols. %p Either "AM" or "PM" according to the given time value, or the corresponding strings for the current locale. Noon is treated as "PM" and midnight as "AM". %P Like %p but in lowercase: "am" or "pm" or a corresponding string for the current locale. %r The time in a.m. or p.m. notation. In the POSIX locale this is equivalent to %I:%M:%S %p. %R The time in 24-hour notation (%H:%M). For a version including the seconds, see %T below. %s The number of seconds since the Epoch, 1970-01-01 00:00:00 +0000 (UTC) %S The second as a decimal number (range 00 to 60). (The range is up to 60 to allow for occasional leap seconds.) (alt O) %t A tab character. %T The time in 24-hour notation (%H:%M:%S). %u The day of the week as a decimal, range 1 to 7, Monday being 1. See also %w. (alt O) %U The week number of the current year as a decimal number, range 00 to 53, starting with the first Sunday as the first day of week 01. See also %V and %W. (alt O) %V The ISO 8601 week number of the current year as a decimal number, range 01 to 53, where week 1 is the first week that has at least 4 days in the new year. See also %U and %W. (alt O) %w The day of the week as a decimal, range 0 to 6, Sunday being 0. See also %u. (alt O) %W The week number of the current year as a decimal number, range 00 to 53, starting with the first Monday as the first day of week 01. (alt O) %x The preferred date representation for the current locale without the time. (alt E) %X The preferred time representation for the current locale without the date. (alt E) %y The year as a decimal number without a century (range 00 to 99). (alt E, alt O) %Y The year as a decimal number including the century. (alt E) %z The +hhmm or -hhmm numeric timezone (that is, the hour and minute offset from UTC). %Z The timezone name or abbreviation. %% A literal '%' character. # List of columns to sort by when reporting 'lvm devtypes' command. See 'lvm devtypes -o help' for the list of possible fields. devtype_name,devtype_max_partitions,devtype_descriptionList of columns to report for 'lvm devtypes' command. See 'lvm devtypes -o help' for the list of possible fields. List of columns to report for 'lvm devtypes' command in verbose mode. See 'lvm devtypes -o help' for the list of possible fields. List of columns to sort by when reporting 'lvs' command. See 'lvs -o help' for the list of possible fields. lv_name,vg_name,lv_attr,lv_size,pool_lv,origin,data_percent,metadata_percent,move_pv,mirror_log,copy_percent,convert_lvList of columns to report for 'lvs' command. See 'lvs -o help' for the list of possible fields. lv_name,vg_name,seg_count,lv_attr,lv_size,lv_major,lv_minor,lv_kernel_major,lv_kernel_minor,pool_lv,origin,data_percent,metadata_percent,move_pv,copy_percent,mirror_log,convert_lv,lv_uuid,lv_profileList of columns to report for 'lvs' command in verbose mode. See 'lvs -o help' for the list of possible fields. List of columns to sort by when reporting 'vgs' command. See 'vgs -o help' for the list of possible fields. vg_name,pv_count,lv_count,snap_count,vg_attr,vg_size,vg_freeList of columns to report for 'vgs' command. See 'vgs -o help' for the list of possible fields. vg_name,vg_attr,vg_extent_size,pv_count,lv_count,snap_count,vg_size,vg_free,vg_uuid,vg_profileList of columns to report for 'vgs' command in verbose mode. See 'vgs -o help' for the list of possible fields. List of columns to sort by when reporting 'pvs' command. See 'pvs -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_freeList of columns to report for 'pvs' command. See 'pvs -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,dev_size,pv_uuidList of columns to report for 'pvs' command in verbose mode. See 'pvs -o help' for the list of possible fields. List of columns to sort by when reporting 'lvs --segments' command. See 'lvs --segments -o help' for the list of possible fields. lv_name,vg_name,lv_attr,stripes,segtype,seg_sizeList of columns to report for 'lvs --segments' command. See 'lvs --segments -o help' for the list of possible fields. lv_name,vg_name,lv_attr,seg_start,seg_size,stripes,segtype,stripesize,chunksizeList of columns to report for 'lvs --segments' command in verbose mode. See 'lvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting 'pvs --segments' command. See 'pvs --segments -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_sizepv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_size,lv_name,seg_start_pe,segtype,seg_pe_rangesList of columns to sort by when reporting 'pvs --segments' command in verbose mode. See 'pvs --segments -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'vgs' subreport. See 'vgs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'vgs' subreport. See 'pvs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'lvs' subreport. See 'lvs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'pvseg' subreport. See 'pvs --segments -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'seg' subreport. See 'lvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'vgs' subreport. See 'vgs -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'vgs' subreport. See 'pvs -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'lvs' subreport. See 'lvs -o help' for the list of possible fields. List of columns to sort by when reporting for lvm fullreport's 'pvseg' subreport. See 'pvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'seg' subreport. See 'lvs --segments -o help' for the list of possible fields. Use brackets [] to mark hidden devices. Use the two words 'unknown device' in place of '[unknown]'. This is displayed when the device for a PV is not known. libdevmapper-event-lvm2mirror.soThe library dmeventd uses when monitoring a mirror device. libdevmapper-event-lvm2mirror.so attempts to recover from failures. It removes failed devices from a volume group and reconfigures a mirror as necessary. If no mirror library is provided, mirrors are not monitored through dmeventd. libdevmapper-event-lvm2raid.solibdevmapper-event-lvm2snapshot.soThe library dmeventd uses when monitoring a snapshot device. libdevmapper-event-lvm2snapshot.so monitors the filling of snapshots and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the snapshot is filled. libdevmapper-event-lvm2thin.soThe library dmeventd uses when monitoring a thin device. libdevmapper-event-lvm2thin.so monitors the filling of a pool and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the pool is filled. The plugin runs command with each 5% increment when thin-pool data volume or metadata volume gets above 50%. Command which starts with 'lvm ' prefix is internal lvm command. You can write your own handler to customise behaviour in more details. User handler is specified with the full path starting with '/'. The library dmeventd uses when monitoring a VDO pool device. libdevmapper-event-lvm2vdo.so monitors the filling of a pool and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the pool is filled. The plugin runs command with each 5% increment when VDO pool volume gets above 50%. Command which starts with 'lvm ' prefix is internal lvm command. You can write your own handler to customise behaviour in more details. User handler is specified with the full path starting with '/'. The full path to the dmeventd binary. Create a host tag using the machine name. The machine name is nodename returned by uname(2). Replace this subsection name with a custom tag name. Multiple subsections like this can be created. The '@' prefix for tags is optional. This subsection can contain host_list, which is a list of machine names. If the name of the local machine is found in host_list, then the name of this subsection is used as a tag and is applied to the local machine as a 'host tag'. If this subsection is empty (has no host_list), then the subsection name is always applied as a 'host tag'. # Example The host tag foo is given to all hosts, and the host tag bar is given to the hosts named machine1 and machine2. tags { foo { } bar { host_list = [ "machine1", "machine2" ] } } # A list of machine names. These machine names are compared to the nodename returned by uname(2). If the local machine name matches an entry in this list, the name of the subsection is applied to the machine as a 'host tag'. Defines the local system ID for lvmlocal mode. This is used when global/system_id_source is set to 'lvmlocal' in the main configuration file, e.g. lvm.conf. When used, it must be set to a unique value among all hosts sharing access to the storage, e.g. a host name. # Example Set no system ID: system_id = "" Set the system_id to a specific name: system_id = "host1" # A list of extra VG system IDs the local host can access. VGs with the system IDs listed here (in addition to the host's own system ID) can be fully accessed by the local host. (These are system IDs that the host sees in VGs, not system IDs that identify the local host, which is determined by system_id_source.) Use this only after consulting 'man lvmsystemid' to be certain of correct usage and possible dangers. The lvmlockd sanlock host_id. This must be unique among all hosts, and must be between 1 and 2000. Applicable only if LVM is compiled with lockd support <#config/config.cSetting %s to %soption%s# Configuration %s %s. %s# %s%s#%s%s string float integer boolean section array with values of type: - %s%s%s%s%s%s%s # Failed to duplicate filename.%s is not a regular file%s is emptyreadconfig_tree allocation failedLoading config file: %sFailed to load config file %sstdoutDumping configuration to %sFailure while writing to %scommand profilemetadata profileUndefined profile name.profile allocation failed%s/%s.profileIgnoring invalid %s %s.%s%s%s/%s.cache%s/%s/%s.cache(root)How LVM uses block devices. shellHost tag settings. abort_on_errorsprofile_dir#S/devloopfilesobtain_device_list_from_udevexternal_device_info_sourcepreferred_namesuse_devicesfilesystem.devicessearch_for_devnames#Sa|.*|global_filtercache_dircache_file_prefixwrite_cache_statesysfs_scanscan_lvsmultipath_component_detectionmultipath_wwids_file/etc/multipath/wwidsmd_component_detectionmd_component_checksfw_raid_component_detectionmd_chunk_alignmentdefault_data_alignmentdata_alignment_detectionignore_suspended_devicesignore_lvm_mirrorsdisable_after_error_countrequire_restorefile_with_uuidpv_min_sizeissue_discardsallow_mixed_block_sizescling_tag_listmaximise_clinguse_blkid_wiping@DEFAULT_USE_BLKID_WIPING@raid_stripe_all_devicescache_pool_cachemodeCache mode. cache_metadata_formatcache_pool_chunk_sizecache_pool_max_chunksthin_pool_crop_metadatathin_pool_zerothin_pool_discardsthin_pool_chunk_size_policygenericzero_metadatathin_pool_chunk_sizephysical_extent_sizevdo_use_compressionvdo_use_deduplicationvdo_use_metadata_hintsvdo_minimum_io_sizevdo_block_map_cache_size_mbvdo_block_map_periodvdo_check_point_frequencyvdo_use_sparse_indexvdo_index_memory_size_mbvdo_slab_size_mbvdo_ack_threadsvdo_bio_threadsvdo_bio_rotationvdo_cpu_threadsvdo_hash_zone_threadsvdo_logical_threadsvdo_physical_threadsvdo_write_policyvdo_max_discardreport_command_logcommand_log_sortlog_seq_numcommand_log_colscommand_log_selectionsilentsyslogoverwritelevelindentcommand_namesactivate_filedebug_classesbackup_dirarchive_dirretain_minretain_dayshistory_sizeumasksi_unit_consistencyfallback_to_lvm1format_librariessegment_libraries/procLocation of proc filesystem. /etc@CONFDIR@locking_typewait_for_locksfallback_to_clustered_lockingfallback_to_local_lockinglocking_dir/run/lock/lvm@DEFAULT_LOCK_DIR@prioritise_write_lockslibrary_dirlocking_libraryliblvm2clusterlock.soabort_on_internal_errorsmetadata_read_onlymirror_segtype_default@DEFAULT_MIRROR_SEGTYPE@support_mirrored_mirror_lograid10_segtype_defaultraid10@DEFAULT_RAID10_SEGTYPE@sparse_segtype_default@DEFAULT_SPARSE_SEGTYPE@event_activationuse_lvmetadlvmetad_update_wait_timeuse_aiouse_lvmlockdlvmlockd_lock_retriessanlock_lv_extendlvmlockctl_kill_commandthin_check_executable/usr/sbin/thin_check@THIN_CHECK_CMD@thin_dump_executable/usr/sbin/thin_dump@THIN_DUMP_CMD@thin_repair_executable/usr/sbin/thin_repair@THIN_REPAIR_CMD@thin_check_optionsthin_repair_options#Sthin_disabled_featurescache_disabled_featurescache_check_executable/usr/sbin/cache_check@CACHE_CHECK_CMD@cache_dump_executable/usr/sbin/cache_dump@CACHE_DUMP_CMD@cache_repair_executable/usr/sbin/cache_repair@CACHE_REPAIR_CMD@cache_check_optionscache_repair_optionsvdo_format_executable/usr/bin/vdoformat@VDO_FORMAT_CMD@vdo_format_optionsvdo_disabled_featuresfsadm_executable/usr/sbin/fsadm@FSADM_PATH@system_id_sourcesystem_id_fileuse_lvmpolld@DEFAULT_USE_LVMPOLLD@notify_dbusio_memory_sizeudev_syncudev_rulesverify_udev_operationsretry_deactivationmissing_stripe_filleruse_linear_targetreserved_stackreserved_memoryprocess_priorityauto_activation_volume_listread_only_volume_listmirror_region_sizeraid_region_sizeraid_fault_policywarnmirror_image_fault_policymirror_log_fault_policyallocatemirror_device_fault_policysnapshot_autoextend_thresholdsnapshot_autoextend_percentthin_pool_autoextend_percentvdo_pool_autoextend_thresholdvdo_pool_autoextend_percentmlock_filteruse_mlockallpolling_intervalauto_set_activation_skipactivation_modedegradedauto_lock_start_listcheck_pv_device_sizesrecord_lvs_historylvs_history_retention_timepvmetadatasizepvmetadataignoredirsdisk_areasdisk_areastart_sectoroutput_formatbasiccompact_outputcompact_output_colslist_item_separator,columns_as_rowsbinary_values_as_numerictime_format%Y-%m-%d %T %zdevtypes_sortdevtype_namedevtypes_colsdevtypes_cols_verboselvs_sortvg_name,lv_namelvs_colslvs_cols_verbosevgs_sortvg_namevgs_colsvgs_cols_verbosepvs_sortpv_namepvs_colspvs_cols_verbosevg_name,lv_name,seg_startpvsegs_sortpv_name,pvseg_startpvsegs_colspvsegs_cols_verbosevgs_cols_fullvg_allpvs_cols_fullpv_alllvs_cols_fulllv_allpvsegs_cols_fullpvseg_all,pv_uuid,lv_uuidseg_all,lv_uuidvgs_sort_fullpvs_sort_fulllvs_sort_fullpvsegs_sort_fullpv_uuid,pvseg_startlv_uuid,seg_startmark_hidden_devicestwo_word_unknown_devicemirror_libraryraid_librarysnapshot_librarythin_librarylvm lvextend --use-policiesvdo_librarylibdevmapper-event-lvm2vdo.so/usr/sbin/dmeventd@DMEVENTD_PATH@hosttagssystem_idextra_system_idshost_idundefinedmerged filesspecial purposeOOOOpOOOO8OOOOOOOOOOOOOOOOOOOOOOOONdldldd\dc,c,c,c4datastruct/btree.cstr_list allocation faileddatastruct/str_list.cstr_list_to_str: string allocation failed.str_to_str_list: string list allocation failed.str_to_str_list: string list item allocation failed.WARNING: %s failed: %s.device/bcache.cmisaligned data bufferio_destroyunable to allocate sync_ioio_geteventsio_setup failed %dsome blocks are still lockedCannot extend bcache fd tableLimit write at %llu len %llu beyond last byte %lluSkip extending write at %llu len %llu limit %llu extra %llu sector_size %lluLimit write at %llu len %llu to len %llu rounded to %lluLimit write at %llu len %llu to len %lluInvalid adjusted write at %llu len %llu adjusted %llu limit %llu extra %llu sector_size %llucouldn't allocate control blockWARNING: bcache_invalidate: block (%d, %llu) still dirty.WARNING: bcache_invalidate: block (%d, %llu) still held.bcache_abort: block (%d, %llu) still heldWARNING: async io still in flight.Device seek error %d for offset %lluDevice seek failed for offset %lluDevice read error %d offset %llu len %lluDevice write error %d offset %llu len %lluDevice read short %u bytes remainingDevice write short %u bytes remainingbcache no new blocks for di %d index %u with >%d errors.bcache no new blocks for di %d index %ubcache unable to insert block in radix tree (OOM?)_SC_PAGESIZE returns negative value.couldn't create control block setWARNING: _SC_PAGESIZE returns negative value.bcache must have at least one cache blockbcache must have a non zero block sizebcache block size must be a multiple of page sizeconcurrent write lock attemptedbcache failed to get block %u di %dref count on bcache block already zerobcache_invalidate: block (%d, %llu) still heldInternal error: Cannot change not opened DI with FD:%dDrop alias for %d:%d %s.device/dev-cache.cdisk/lstatfilename strdup failed%s: New preferred namefgets%sdev/block/%d:%d/dm/uuidIgnoring %s: %s.Ignoring %s: Not a directory.dir_list allocation failedNo devno %d:%d in dev cache.dev_iter allocation failed/dev/nvmeFound nvme device %sFound dev %d:%d %s - new.Dir path %s is too longPath %s/%s is too long.%s: Not available device node%sdev/block/%d:%d/holders/opendir%sblock/%s/devclosedir%sdev/blockFailed to udev_enumerate_new.not found in configdev_cachestrdup dev_dir failed.preferred device name matcherNot a block device %s.Failed to get device %s%s/devices/dmeventd.devicesFailed to copy devices path%s/devicesCreating %s.Failed to create %s %d%s/devices/%sDevices file not found: %spvcreatevgcreateCannot access device %s.Invaild device type %s.%s: failed to allocate device list for device cache index.%s: failed to insert device list to device cache index.struct device allocation failedstruct dm_str_list allocation failed_get_sysfs_value: %s: no value%d:%d: dm_snprintf failed for path to sysfs dm directory.Drop alias for %d:%d invalid path %s %d:%d.Failed to add allias to dev cache.Couldn't add name to hash in dev cache.Found dev %d:%d %s - exists. %.8sCouldn't insert device into binary tree.Found dev %d:%d %s - new alias.Found dev %d:%d %s - existing device, path was previously %d:%d.Found dev %d:%d %s - new device, path was previously %d:%d.Found dev %d:%d %s - failed to use.%s: Symbolic link to directory%s: Different filesystem in directory_insert_sysfs_dev: %s: dm_snprintf failedCouldn't add device to binary tree of sysfs-only devices in dev cache.%s: dm_snprintf failed for path to holders directory.%s: path does not exist, skipping%s: dm_snprintf failed for holder %s device path._get_device_for_sysfs_dev_name_using_devno: %s: dm_snprintf failed_get_device_for_sysfs_dev_name_using_devno: %s: failed to get major and minor number%s: failed to find associated device structure for holder %s.%s: failed to allocate dev list item.dev_cache_index_devs: dm_snprintf failed._dev_cache_iterate_sysfs_for_index: %s: failed to get major and minor numberCreating list of system devices.WARNING: Cannot use dir %s, %s.Failed to udev_enumerate_add_match_subsystem.Failed to udev_enumerate_scan_devices.udev failed to return a device for entry %s.udev failed to return a device node for entry %s.udev failed to return a symlink name for entry %s.%s: Failed to insert devices from udev-managed directory to device cache fully%s: Failed to insert devices to device cache fullyDevice '%s' has been left open (%d remaining references).Internal error: %d device(s) were left open and have been closed.Couldn't create binary tree for dev-cache.Couldn't create binary tree for sysfs-only devices in dev cache.devices/preferred_names %s: using built-in preferencespreferred_names patterns must be enclosed in quotesFailed to allocate preferred device name pattern list.Failed to allocate a preferred device name pattern.Preferred device name pattern matcher creation failed.Ignoring dev with no valid paths for %s.Device path %s is invalid for %d:%d %s.Dropping aliases for device entry %d:%d %s for new device %d:%d %s.Dropping aliases for %d:%d before adding new path %s.dev_cache_get filter deferred %sdev_cache_get filter excludes %sget device by iter defer filter %sInvalid devices file name from config setting "%s".Failed to copy devices dir pathFailed to copy devices file pathFailed to lock the devices file to create.Failed to lock the devices file.Failed to read the devices file.Devices file not found, ignoring.Failed to lock the devices file to read.part%sdev/block/%d:%d/%sdevice/device_id.c%s/D_%s/run/lvm/searched_devnamesunlink %s errno %dunlink %sCRYPT-device/serialmpath-md/uuidloop/backing_filesys_wwidsys_serialdevnamempath_uuidcrypt_uuidlvmlv_uuidmd_uuidloop_fileQEMU HARDDISK(deleted)No idtype %s for %s/dev/mapper/Match device_id %s %s to %s/dev/dm-device_ids_read already donedevice_ids_read %sSYSTEMIDread devices file systemid %sVERSIONread devices file version %sIDTYPEIDNAMEDEVNAMEPVIDPARTmissing deviceDevice not added.Device not found for %s.Creating devices file %s%s_neww+SYSTEMID=%s VERSION=%u.%u.%uWrote devices file %sDevices file update skipped.Drop incorrectly matched %sSearch for PVID %s.stat %s errno %dSearch for PVIDs filtering.usablempathfwraidFailed to create sysfs path for %sWARNING: devices file already locked %dWARNING: devices file lock file already open %dlock_devices_file open errno %dlock_devices_file flock errno %dMatch device_id %s %s to %s: ignoring idname %sMatch device_id %s %s to %s: using other dm name, ignoring %sMatch device_id %s %s to %s: dm namesCannot open devices file to read.WARNING: devices file has unmatching system id %s vs local %s.WARNING: failed to process devices file entry.WARNING: cannot open devices file to read.check devices file version %s prev %sWARNING: ignoring unknown device_id type %s.WARNING: ignoring device_id name %s.WARNING: ignoring deviceidtype %s which is not available for device.Missing support for DRBD idtypedevice_id_add %s pvid %s matches entry %p dev %sdevice_id_add %s pvid %s matches entry %p dev %s with same pvid %sdevice_id_add %s pvid %s matches entry %p dev %s with same device_id %d %sdevice_id_add %s pvid %s matches entry %p dev %s with same devname %sWARNING: adding device %s with PVID %s which is already used for %s device_id %s.WARNING: adding device %s with idname %s which is already used for missing device.Using separate entries for partitions of same device %s part %d %s part %d.WARNING: adding device %s with idname %s which is already used for %s.Add device with duplicate PV to devices file?Adding new entry to devices file for %s PVID %s %s %s.Updating existing entry in devices file for %s that matches %s %s.WARNING: devices to use does not include %scompare devices file entries to devicesdevices idname %s previously matched %sdevices entry %s %s devname found but not matchedDevice %s not matched to device_idDevices file PVID %s last seen on %s not found.Devices file PVID %s not found.Devices file %s %s PVID %s last seen on %s not found.Devices file %s %s PVID %s not found.Cannot create devices file, missing devices directory %s.device_ids_write create %d edit %d pending %d exists %d version %s devicesfile %sNot creating system devices file due to existing VGs.WARNING: not updating devices file with unparsed version.WARNING: not updating devices file with larger major version.Cannot open tmp devices_file to write.# LVM uses devices listed in this file. # Created by LVM command %s pid %d at %sIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s PART=%d IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s Failed to replace devices file errno %dWARNING: devices file unlock no fdWARNING: devices file unlock not lockedWARNING: devices file unlock errno %ddevice_id update %s pvid %s vgid %s to %sSkip devices file update (busy).Skip devices file update (changed).validating devices file entriesDevices file %s is excluded: %s.Device %s has PVID %s (devices file %s)Device %s has no PVID (devices file %s)Device %s has updated name (devices file %s)du for pvid %s unexpected idname %s mismatch dev %sDevices file PVID %s not found on device %s (device PVID %s).Devices file PVID %s not found on device %s.device ids validate checked %d update disabled.device ids validate checked %d trying to update devices file.device ids validate checked %d found no update is needed.Search for PVIDs skipped for %sSearch for PVIDs reading labels on %d devs.WARNING: found PVID %s on multiple devices %s %s.WARNING: duplicate PVIDs should be changed to be unique.WARNING: use lvmdevices to select a device for PVID %s.Devices file PVID %s found on %s.Search for PVIDs other_pvid %d no_pvid %d other_idtype %d.Devices file PVID %s updating IDNAME to %s.WARNING: new device %s for PVID %s is excluded: %s.Search for PVIDs update disabledSearch for PVIDs updating devices fileSearch for PVIDs found no updatesdevice/dev-ext.cUdev database has incomplete information about device %s.%s: Failed to get external handle [%s].%s: External handle [%s:%p] attached%s: Failed to release external handle [%s:%p]%s: External handle [%s:%p] detached%s: Failed to enable external handle [%s].%s: Failed to disable external handle [%s].device/dev-io.cClosed %s O_EXCLRWRO%s: Not using O_NOATIME%s: Not using O_DIRECTOpened %s %s%s%s (test mode - suppressed)%s: size is %lu sectors%s: read_ahead is %u sectorsAttempt to close device '%s' which is not open.%s: Immediate close attempt while still referencedCannot open device %d:%d with no valid paths.%s: Already opened read-only. Upgrading to read-write.dev_open(%s) called while suspendedFailed to open device path %s (%d).%s: fstat failed: Has device name changed?Discarding %lu bytes offset %lu bytes on %s. %sWARNING: %s: ioctl BLKDISCARD at offset %lu size %lu failed: %s.%s: using cached size %lu sectorsWARNING: %s: ioctl BLKGETSIZE64 %sWARNING: Failed to open %s to get readahead %s.WARNING: %s: ioctl BLKRAGET %s.device/dev-md.c%s/dev/block/%d:%d/md/%sdm_snprintf md %s failed%s/block/md%d/md/%sdm_snprintf old md %s failedIntel Raid ISM Cfg Sig. ID_FS_TYPElinux_raid_memberDevice %s %s is %lu bytes.Device %s %s is %s.raid%draid_disksDevice %s %s is %d.metadata_version1.00.90Found md ddf magic at %llu wrong crc %x disk %x %s_md_sysfs_attribute_scanf fopen failed %s_md_sysfs_attribute_scanf fgets failed %s%s sysfs attr %s not in expected format: %sInternal error: dev_is_md_component_native requires io layer.Found md magic number at offset 0 of %s.Found md magic number at offset 4096 of %s.Found md magic number at offset %llu of %s.Found md imsm magic number at offset %llu of %s.Found md ddf magic number at offset %llu of %s.Device %s has an unknown md raid level: %dDevice %s stripe-width is %lu bytes.h_l_________l_Ignoring unknown multipath_wwids_file.multipath wwids file not foundmultipath wwids read %d from %smultipath config ignored %d wwidsSysfs path string is too long.Cannot find device name in sysfs path.Cannot find '/' in device name.Failed to get primary device for %d:%d.Sysfs path to check mpath is too long.dm device path to check mpath is too long.dev_is_mpath_component %s holder %s stat result %ddev_is_mpath_component %s holder %s %d:%d does not have dm majordev_is_mpath_component %s holder %s %u:%u already checked as %sbeing mpath.dev_is_mpath_component %s holder %s %u:%u ignore mpath componentmpath hash table creation failed.multipath wwids file disabled.dev_is_mpath_component %s no primary devdev_is_mpath_component %s %s in wwids fileSysfs path to check mpath components is too long.Failed to create sysfs wwid path for %sdevice/dev-mpath.cdevice/vpd_pg83blacklist_exceptionsblacklistmultipath wwid %s in %s %s/etc/multipath.conf/etc/multipath/conf.d/etc/multipath/conf.d/%snot %sdev/block/%d:%dreadlinkDevice name is not valid.%sblock/%s/holdersPath %s is not a directory.Device %s has no holders dir%sblock/%s/dm/uuidmpath pool creation failed.naa.eui.t10.unknown wwid type %smpath_memberDM_MULTIPATH_DEVICE_PATH%s/dev/block/%d:%d/slavesDevice %s has no slaves dir%s/block/%s/device/wwidscsi_debugdevice/dev-swap.cSWAP-SPACESWAPSPACE2S1SUSPENDS2SUSPENDULSUSPEND%s/dev/block/%d:%d/partitiondevice/dev-type.cAborted wiping of %s.Wiping %s on %s.Failed to wipe %s on %s.Failed to read %s.Failed to parse %s '%s'.%s/dev/block/%d:%d/%sblkextdrbddasdemcpowerVxDMPlooppower2device-mapperNVMEDMDRBDDASDEMCPOWERPOWER2VXDMPBLKEXTLOOP%sdev/block/%d:%d/partitionID_PART_TABLE_TYPEDEVTYPE%s/dev/block/%d:%d%s/block/%s/devsysfs file %s does not exist.Device %s: %s is %lu%s.BLOCK_SIZELVM2_memberLVM1_memberDM_snapshot_cowSBMAGIC_OFFSETSBMAGICPTTYPEPTMAGIC_OFFSETPTMAGICpartition tableUSAGELABELsoftware RAID md superblockswap signatureLUKS signaturealignment_offsetqueue/minimum_io_sizequeue/optimal_io_sizequeue/discard_max_bytesqueue/discard_granularityqueue/rotationalqueue/daxSCSI diskIDE diskMultiple Disk (MD/SoftRAID)Loop deviceRAM diskMapped devicePartitionable MDDAC960Network Block DeviceCompaq SMART2Compaq CCISS arrayATA RaidEMC Powerpathi2o Block DiskiSeries disksNetwork block deviceATA over EthernetXen virtual block devicePlayStation 3 internal diskVirtIO diskMMC block deviceExtended device partitionsFusion IOMicron PCIe SSDViolin MemorySTECbcache block device cacheNVM ExpressZFS ZvolsVeritas Dynamic MultipathingWARNING: %s: partition path is too long.Fatal error while trying to detect %s on %s.WARNING: %s detected on %s. Wipe it? [y/n]: %sdev/block/%d:%d/loop/partscanSysfs path for partscan is too long.WARNING: sysfs path for %s attribute is too long.Sysfs dm uuid path for %s is too long.Failed to allocate device type register.No proc filesystem found: using all block device typesFailed to create /proc/devices stringWARNING: /proc/devices line: %s, replacing major with %d.Expecting string in devices/types in config fileMax partition count missing for %s in devices/types in config fileZero partition count invalid for %s in devices/types in config fileFailed to read sysfs path for %sFailed to read sysfs partition value for %sInternal error: dev_is_partitioned_native requires i/o.WARNING: %s: major:minor sysfs path is too long.WARNING: Readlink of %s failed.WARNING: sysfs path for %s is too long.WARNING: sysfs file %s not in expected MAJ:MIN format: %sWARNING: sysfs file %s not in expected format: %sWARNING: Device %s: %s is %lu and is unexpectedly less than sector.Found blkid BLOCK_SIZE %u for fs on %sNo blkid BLOCK_SIZE for fs on %sFailed to create a new blkid probe for device %s.Failed to get offset of the %s signature on %s.WARNING: Failed to get offset of the %s signature on %s. Wiping skipped.Failed to get length of the %s signature on %s.WARNING: Failed to get length of the %s signature on %s. Wiping skipped.Found existing signature on %s at offset %s: LABEL="%s" UUID="%s" TYPE="%s" USAGE="%s"WARNING: %s signature detected on %s at offset %s. Wipe it? [y/n]: Failed to wipe %s signature on %s.Failed to step back blkid probe to check just wiped signature.%d existing signature%s left on the device.DASD disk (IBM S/390, zSeries)User-mode virtual block deviceDistributed Replicated Block Device (DRBD)SUN's LDOM virtual block deviceStorage Class Memory (IBM S/390)Wiping %s signature on %s.device/dev-luks.cLUKSdevice/dev-dasd.cioctl BIODASDINFO2t10.%seui.%snaa.%scling_by_tagsnext freedisplay/display.cclvm%.2fPercentage %d does not fit.--- Physical Segments ---Physical extent %u to %u: Logical volume %s%s/%s Logical extents %d to %d FREENEW (exported)(but full)--- %sPhysical volume ---PV Name %sVG Name %s%sPV Size %sAllocatable yes %sAllocatable NOPE Size %sPE Size (KByte) %uTotal PE %uFree PE %uAllocated PE %uPV UUID %sNOT PV Name %s Total PE / Free PE %u / %uread/writeread onlyINACTIVE (partial)LV Name %s%sVG Name %sLV UUID %sLV Creation time %sLV Removal time %s--- Logical volume ---LV Name %sInternal LV Name %sLV Write Access %sLV Creation host, time %s, %sLV Pool name %sLV Thin origin name %sLV External origin name %sLV merging to %sLV merged with %sLV Pool metadata %sLV Pool data %sLV origin of Cache LV %sLV Cache pool name %sLV Cache origin name %sLV VDO Pool data %sLV VDO Pool usage %s%%LV VDO Pool saving %s%%LV VDO Operating mode %sLV VDO Index state %sLV VDO Compression st %sLV VDO Used size %sLV VDO Pool name %s# open %uLV Size %sCache used blocks %s%%Cache metadata blocks %s%%Cache dirty blocks %s%%Cache demotions %luCache promotions %luAllocated pool data %s%%Allocated metadata %s%%Mapped size %s%%Current LE %uCOW-table size %sCOW-table LE %uAllocated to snapshot %s%%Snapshot chunk size %sMirrored volumes %uSegments %uAllocation %sRead ahead sectors autoRead ahead sectors 0Read ahead sectors %u- currently set to %uBlock device %d:%dPersistent minor %dPersistent major %dMissing%sPhysical volume %s%sPhysical extents %d to %d%sLogical volume %s%sLogical extents %d to %d%sUnassigned areaVirtualLogical--- Segments ---%s extents %u to %u: Type %s Monitoring %sexported/--- Volume group ---VG Name %sSystem ID %sFormat %sMetadata Areas %dMetadata Sequence No %dClustered yesShared %sMAX LV %uCur LV %uOpen LV %uMax PV %uCur PV %uAct PV %uVG Size %sAlloc PE / Size %u / %sFree PE / Size %u / %sVG UUID %sr/wName is zero length.WARNING: Invalid input '%s'.[n] Accepted input: [%c]PVSUnrecognised allocation policy %sFull LV name "%s/%s" is too long.%s:%s:%lu:-1:%lu:%lu:-1:%u:%u:%u:%u:%sPV Size %s / not usable %sPV Status %sallocatable%s%s/%s:%s:%lu:%d:-1:%d:%lu:%d:-1:%d:%d:%d:%dread/write (activated read only)--- Historical Logical volume ---LV Name %s%s/%sLV Path %s%s/%sLV snapshot status source of %s%s/%s [%s] %s [%s]LV snapshot status %s destination for %s%s/%sLV snapshot status %s destination for %sLV Status suspendedLV Status %savailable%sCache read hits/misses %lu / %luCache wrt hits/misses %lu / %luLV type Mirror undergoing conversionVG Access %s%s%s%sVG Status %s%sresizable%s:%s:%lu:-1:%u:%u:%u:-1:%u:%u:%u:%lu:%u:%u:%u:%u:%s"%s" %-9s [%-9s used / %s free]Name cannot start with hyphen.Name starts with . or .. and has no following character(s).Name contains invalid character, valid set includes: [a-zA-Z0-9.-_+].Name length exceeds maximum limit of %d.Internal error: Unknown error %d on name validation.P@ 04d,noyescontiguouscclinglcling_by_tagstnormalnanywhereainheritierror/errseg.cerroerror module string list allocation failedimporting unknown segmentunknown/unknown.cstart_extentFailed to allocate name.Failed to allocate memory for unknown segtypeInternal error: Destroying composite filter while in use %u times.Composite filters allocation failed.filters/filter-composite.ccompositeComposite filter initialised.Internal error: Destroying persistent filter while in use %u times.%d:%d: filter cache skipping (no name)%s: filter cache skipping (cached bad)%s: filter cache using (cached good)Failed to hash alias to filter.Allocation of persistent filter failed.Couldn't create hash table for persistent filter.Allocation of device filter for persistent filter failed.Persistent filter initialised.filters/filter-persistent.cgoodbadfilter cache deferred %sfilter caching %s %sInternal error: Destroying regex filter while in use %u times.Please remove the lvm.conf filter, it is ignored with the devices file.Please remove the lvm.conf global_filter, it is ignored with the devices file.Filter patterns must be enclosed in quotes.Pattern must begin with 'a' or 'r'.Invalid separator at end of regex.filters/filter-regex.c%s: Skipping (regex)filter regexfilter dm_regexFailed to allocate regex.Failed to create bitset.Invalid filter pattern "%s".Regex filter initialised.Internal error: Destroying sysfs filter while in use %u times.filter-sysfs disabled: /sys/dev/block not foundNo proc filesystem found: skipping sysfs filterfilters/filter-sysfs.cfailed to create sysfs path%s: Skipping (sysfs)Sysfs filter initialised.Internal error: Destroying md filter while in use %u times.md filter full %d excluding md component %s%s: Skipping md component device%s: Skipping md component device [%s:%p]%s: Skipping: error in md component detectionfilters/filter-md.cfilter md deferred %smd filter allocation failedMD filter initialised.Internal error: Destroying firmware RAID filter while in use %u times.%s: Firmware RAID detection is not supported by LVM natively. Skipping firmware raid detection. Internal error: Missing hook for firmware RAID recognition using external device info source %s%s: Skipping firmware RAID component device%s: Skipping firmware RAID component device [%s:%p]Firmware RAID filter allocation failedFirmware RAID filter initialised.filters/filter-fwraid.cInternal error: Destroying mpath filter while in use %u times.%s: Skipping mpath component deviceNo proc filesystem found: skipping multipath filtermpath filter allocation failedfilters/filter-mpath.cmpath filter initialised.Internal error: Destroying partitioned filter while in use %u times.filter partitioned deferred %s%s: Skipping: Partition table signature found%s: Skipping: Partition table signature found [%s:%p]Partitioned filter allocation failedPartitioned filter initialised.filters/filter-partitioned.cInternal error: Destroying lvm_type filter while in use %u times.%s: Skipping: Unrecognised LVM device type %luLVM type filter allocation failedfilters/filter-type.cLVM type filter initialised.Internal error: Destroying usable device filter while in use %u times.%s: Skipping: dev_get_size failedUsable device filter allocation failedUsable device filter mode allocation failedUsable device filter initialised (scan_lvs %d).filters/filter-usable.c%s: Skipping unusable device.%s: Skipping: %sToo small to hold a PVInternal error: Destroying internal filter while in use %u times.%s: Skipping for internal filtering.filters/filter-internal.cinternalInternal filter initialised.Internal error: Destroying signature filter while in use %u times.%s: Skipping: error in signature detectionfilters/filter-signature.c%s: Skipping lvm1 device%s: Skipping gfs-pool devicefilter signature deferred %ssignature filter initialised.Internal error: Destroying deviceid filter while in use %u times.deviceid filter allocation failedfilters/filter-deviceid.c%s: Skipping (deviceid)deviceiddeviceid filter initialised.format_text/archive.cFile: %s/%sUnable to read archive file.VG name: %sDescription: %sBackup Time: %s%s/%s_%05u-%d.vgArchive file name too long.Expiring archive %sunlinkArchive rename failed for %sNo archives found in %s.Archive file %s not found.Created path %s/%s is too long.Couldn't create text instance object.Couldn't scan the archive directory (%s).Couldn't create new archive file.Couldn't create temporary archive name.Couldn't create FILE object for archive.Consider pruning %s VG archive with more then %u MiB in %u files (check archiving is needed in lvm.conf).Internal error: Passed file path name %s is too long.*before**after*Failed to allocate desc.format_text/archiver.cCreated %s executing '%s'Failed to build desc.archive_params alloc failedbackup_params alloc failedFailed to find device for PV.Zeroing start of device %s%s not wiped: abortingTest mode: Skipping archiving of volume group.Cannot archive volume group metadata for %s to read-only filesystem.Archiving volume group "%s" metadata (seqno %u).Couldn't copy archive directory name.Couldn't copy backup directory name.Failed to generate backup filename (for removal).Couldn't create text format object.Failed to setup physical volume "%s".Failed to allocate PV list item for "%s".Set up physical volume for "%s" with %lu available sectors.Failed to allocate format instance.Deleting existing metadata for VG %s.Removal of existing metadata for VG %s failed.Failed to duplicate empty name.Failed to find cached info for PV %s.Failed to allocate structure for scheduled writing of PV '%s'.Format-specific setup for %s failed.Failed to wipe existing label on %sConsider using option --force to restore Volume Group %s with thin volumes.WARNING: Forced restore of Volume Group %s with thin volumes.Cannot restore Volume Group %s with %i PVs marked as missing.Failed to generate backup filename (for restore).Creating volume group backup "%s" (seqno %u).Couldn't create backup object.Internal error: No in use metadata areas to write.Failed to generate volume group metadata backup filename.WARNING: This metadata update is NOT backed up.Test mode: Skipping backup of volume group.Skipping backup of volume group on read-only filesystem.Backup of volume group %s metadata failed.Skipping check for current backup, since backup is disabled.WARNING: Failed to generate backup pathname %s/%s.Internal error: problem tracking indentationDoubling metadata output buffer to %u# Generated by LVM2 version %s: %scontents = "Text Format Volume Group"creation_host = "%s" # %s %s %s %s %screation_host_system_id = "%s"Could not allocate memory for string list buffer.Internal error: PV name for uuid %s missing from text metadata export hash table.pv device name size is out of bounds.Could not allocate memory for ancestor list buffer.Internal error: Missing PV for area %u of %s segment of LV %s.RAID segment has non-RAID areasInternal error: Invalid type for area %u of %s segment of LV %s.text_export buffer allocation failedCould not format metadata for VG %s.Error parsing metadata for VG %s.format_text/export.cuname failed: %sBuffer reallocation failed.MegabytesKilobytes# %g %s# Hint only%s = %lustatus = %sflags = %s2.03.14(2)-RHEL8 (2021-10-20)version = %ddescription = "%s"creation_time = %lu # %s%s = %s%s {creation_timecreation_host = "%s"lock_args = "%s"allocation_policy = "%s"profile = "%s"read_ahead = -1# Noneread_ahead = %umajor = %dminor = %dsegment_count = %usegment%u {start_extent = %uextent_count = %ureshape_count = %utype = "%s%s"physical_volumes {device = "%s"device_id_type = "%s"device_id = "%s"dev_size = %lupe_start = %luba_start = %luba_size = %luseqno = %uformat = "%s"# informationalsystem_id = "%s"lock_type = "%s"extent_size = %umax_lv = %umax_pv = %umetadata_copies = %utext pv_namespv%dhistorical_logical_volumes {removal_timeorigin = "%s%s"descendants = %s%ss = ["%s", %u%s"%s", "%s"%sGigabytesTerabytesPetabytesExabytes?@P?Internal error: Unknown flag set requested.Internal error: Metadata inconsistency: Not all flags successfully exported.Cannot duplicate segment string.WARNING: Unrecognised flag %s in segment type %s.format_text/flags.cStatus value is not a string.CACHE_VOLUnknown status flag '%s'.PARTIAL+%sREADWRITEWRITE_LOCKEDFIXED_MINORVISIBLEPVMOVENOTSYNCEDREBUILDRESHAPE_DATA_OFFSETRESHAPE_DELTA_DISKS_PLUSRESHAPE_DELTA_DISKS_MINUSREMOVE_AFTER_RESHAPEWRITEMOSTLYACTIVATION_SKIPNOAUTOACTIVATEERROR_WHEN_FULLMETADATA_FORMATCROP_METADATACACHE_USES_CACHEVOLALLOCATABLEEXPORTEDMISSINGRESIZEABLECLUSTEREDSHAREDformat_text/format-text.cUnlinking %sRenaming %s to %s%s: rename to %s failed: %sTest mode: Skipping renameFailed to read VG %s from %sRead volume group %s from %smda_context allocation failed LVM2 x[5A%r0N*>fdopenWriting %s metadata to %sfsyncpe_startMDA1 startdisk sizeMDA0 endlabel scan sizepe_endba_endPV %s missing from cache%s.tmp(ignored)(used)empty preWrite from %s.Write[%u] from %s.VG %s metadata writing failedFailed to read vg %s from %sVG %s not found on %sWARNING: No cache info for %sFailed to allocate dir_listtext_orphanInitialised format: %sTest mode: Skipping committing %s metadata (%u)Committing file %s metadata (%u)Renaming path %s is too long for VG %s.'%s' does not contain volume group '%s'.PV init requested data_alignment_sectors %llu data_alignment_offset_sectors %lluPV init config data_alignment_sectors %llu%s: pe_align (%llu sectors) must not be less than pe_align_offset (%llu sectors)PV init final alignment %llu sectors from align %llu align_offset %llu%s: Data alignment must not exceed device size.%s: Bootloader area with data-aligned start must not exceed device size.Setting pe start to %llu sectors after ba start %llu size %llu for %sSetting PE start to %llu sectors for %sSetting pe start to requested %llu sectors for %s%s: Bootloader area would overlap data area.Physical extents (%s) end beyond end of device (%s) %s.Reading mda header sector from %s at %lluFailed to read metadata area header on %s at %lluWARNING: wrong checksum %x in mda header on %s at %lluWARNING: wrong magic number in mda header on %s at %lluWARNING: wrong version %u in mda header on %s at %lluWARNING: wrong start sector %llu in mda header on %s at %lluFailed to write mda header to %s.Internal error: can't remove metadata area with index %u from PV %s. Metadata layou not supported by %s format.Text format failed to determine directory.Couldn't create temporary text file name.Failed to write metadata to %s.Creating metadata area on %s at sector %lu size %lu sectorsInternal error: invalid index of value %u used while trying to add metadata area on PV %s. Metadata layout not supported by %s format.Internal error: metadata area with index %u already exists on PV %s and removal failed.Using limited metadata area size on %s with value %lu (limited by %s of %lu).Metadata area size too small: %lu bytes. It must be at least %u bytes.Failed to wipe new metadata area on %s at %llu len %llustruct metadata_area allocation failedstruct mda_context allocation failedNot enough space available for metadata area with index %u on PV %s.Failed to move metadata area with index 1 while resizing PV %s.PV %s too large for extent size %s.Random lvid creation failed for %s/%s.PV %s header needs rewrite for new ext versionPV %s header needs rewrite to set ext usedCouldn't allocate text_fid_context.%s: Volume group filename may not end in .tmpCouldn't allocate text format context object.Couldn't create metadata index for format instance of VG %s.No cached vginfo for VG %s and ID %s.struct mda_header allocation failedWARNING: Removing metadata location on %s with bad mda header.Failed to write metadata area headerVG %s metadata %scommit %sseq %u on %s mda header at %llu %s.VG %s metadata %scommit %sslot0 offset %llu size %llu slot1 offset %llu size %llu.VG %s seqno %u metadata write to %s mda_start %llu mda_size %llu mda_last %lluVG %s %u metadata on %s (%llu bytes) exceeds maximum metadata size (%llu bytes)VG %s %u new metadata start align from %llu to beginning %uVG %s %u new metadata start align from %llu to %llu (+%llu)VG %s %u wrapping metadata new_start %llu new_size %llu to size1 %llu size2 %lluVG %s %u metadata area location old start %llu last %llu size %llu wrap %lluVG %s %u metadata area location new start %llu last %llu size %llu wrap %lluVG %s %u metadata on %s (%llu bytes) too large for circular buffer (%llu bytes with %llu used)VG %s %u metadata disk location start %llu size %llu last %lluVG %s %u metadata disk location write1 start %llu size %llu last %llu write2 start %llu size %llu last %lluVG %s %u metadata last align from %llu to %llu (+%u)VG %s %u %s adjusted metadata end %llu extra %u larger than write buffer %lluVG %s %u metadata last align from %llu to %llu (+%u) (wrapped)VG %s %u %s adjusted metadata end %llu wrap %llu extra %u larger than write buffer %lluVG %s %u %s metadata write size %llu %llu larger than buffer %lluVG %s %u metadata write at %llu size %llu (wrap %llu)VG %s %u metadata write at %llu size %llu (wrapped)Failed to write metadata wrap to %sWARNING: Failed to read metadata text at %llu off %llu size %llu VG %s on %sFound metadata text at %llu off %llu size %llu VG %s on %sWARNING: reading %s mda%d failed to read metadata.WARNING: repair VG metadata on %s with vgck --updatemetadata.Internal error: read_metadata_location_summary called with NULL pointer for mda_headerMetadata location on %s at %llu has offset 0.Skipping read of already known VG metadata with matching mda checksum on %s.WARNING: metadata on %s at %llu has invalid summary for VG.WARNING: metadata on %s at %llu has invalid VG name.Found metadata summary on %s at %llu size %llu for VG %sFailed to allocate text format type structure.Couldn't create text label handler.Couldn't register text label handler.Failed to read outdated pv mda header on %sFailed to write outdated pv mda header on %s LVM2 x[5A%r0N*>format_text/import.cReading metadata summary from %s at %llu size %d (+%d)WARNING: invalid metadata text from %s at %llu.WARNING: invalid metadata text from file.Skipped parsing metadata on %sFailed to allocate VG fmtdata for text format.Reading metadata from %s at %llu size %d (+%d)WARNING: couldn't read volume group metadata from %s.WARNING: couldn't read volume group metadata from file.There are %d physical volumes missing.descriptionCould not find status flags.format_text/import_vsn1.cCould not read status flags.Could not read flags.Couldn't find section '%s'.Importing logical volume %s.creation_hostcontentsmissing contents fieldText Format Volume Groupunrecognised contents fieldmissing version numberunrecognised version numberCouldn't find uuid.Invalid uuid.Empty pv section.dev_sizeEmpty logical volume section.Empty segment section.reshape_countSegment allocation failed_mimagetmpsegment_countmax_lvmax_pvmetadata_copiesphysical_volumeshistorical_logical_volumesread_vgCouldn't read pv summariesUnknown historical logical volume %s/%s%sCouldn't read origin for historical logical volume %s/%s%sCouldn't get descendants list for historical logical volume %s/%s%sFound empty descendants list for historical logical volume %s/%s%sFailed to allocate list item for historical logical volume %s/%s%sUnknown origin %s for historical logical volume %s/%s%sDescendant value for historical logical volume %s/%s%s is not a string.Failed to find descendant %s for historical LV %s.Found an item that is not a stringEmpty logical volume section for %s.Couldn't read status flags for logical volume %s.Invalid creation_time for logical volume %s.Couldn't read creation_host for logical volume %s.Missing creation_time for logical volume %s.WARNING: Ignoring unrecognised allocation policy %s for LV %s.Adding profile configuration %s for LV %s.Failed to add configuration profile %s for LV %s.Couldn't read tags for logical volume %s.Couldn't use another pool metadata spare logical volume %s.Logical volume %s is pool metadata spare.Logical volume %s is sanlock lv.Can't process text format file - %s.Couldn't read uuid for physical volume.Couldn't read status flags for physical volume.Couldn't read dev size for physical volume.Failed to allocate memory for device hint in read_pv.Failed to allocate memory for device_id in read_pv.Failed to allocate memory for device_id_type in read_pv.Couldn't read extent start value (pe_start) for physical volume.Couldn't find extent count (pe_count) for physical volume.Found bootloader area specification for PV %s in metadata: ba_start=%lu, ba_size=%lu.Found incomplete bootloader area specification for PV %s in metadata.Couldn't read tags for physical volume %s in %s.Lost logical volume reference %sCouldn't read uuid for logical volume %s.Couldn't read 'start_extent' for segment '%s' of logical volume %s.Couldn't read 'extent_count' for segment '%s' of logical volume %s.Segment type must be a string.Cannot duplicate segtype string.Couldn't read segtype for logical volume %s.Couldn't read tags for a segment of %s/%s.Only one segment permitted for snapshotCouldn't read segment count for logical volume %s.segment_count and actual number of segments disagree for logical volume %s.Couldn't read minor number for logical volume %s.WARNING: Couldn't read major number for logical volume %s.WARNING: Ignoring invalid major, minor number for logical volume %s.Couldn't create pv hash table.Couldn't create lv hash table.Unrecognised format %s for volume group %s.Couldn't read uuid for volume group %s.Couldn't read 'seqno' for volume group %s.Error reading flags of volume group %s.Failed to allocate memory for system_id in _read_vg.Couldn't read extent size for volume group %s.Couldn't read 'max_lv' for volume group %s.Couldn't read 'max_pv' for volume group %s.WARNING: Ignoring unrecognised allocation policy %s for VG %sAdding profile configuration %s for VG %s.Failed to add configuration profile %s for VG %sCouldn't find all physical volumes for volume group %s.Couldn't read tags for volume group %s.Couldn't read all logical volume names for volume group %s.Couldn't read all historical logical volumes for volume group %s.Couldn't read all logical volumes for volume group %s.Couldn't read all removed logical volume interconnections for volume group %s.Failed to fixup mirror pointers after import for volume group %s.Couldn't find volume group in file.Empty removed logical volume section.Couldn't read uuid for removed logical volume %s in vg %s.Invalid creation_time for removed logical volume %s.Invalid removal_time for removed logical volume %s.Removed logical volume structure allocation failedCouldn't find status flags for volume group %s.Couldn't read seqno for volume group %s.Failed to allocate memory for device hint in read_pv_sum.Failed to allocate memory for device_id in read_pv_sum.Failed to allocate memory for device_id_type in read_pv_sum.Bad volume name in areas array for segment %s.Missing offset in areas array for segment %s.Bad offset in areas array for segment %s.Zero areas not allowed for segment %sCouldn't find volume '%s' for segment '%s'.Incorrect number of areas in area array for segment '%s'.s, mda2 ( mda1 ( da1 (format_text/text_label.c ba1 (Retrying metadata scan.Scanning %s found no mdas.Scanning %s mda1 summary.Scanning %s mda2 summary.Internal error: %s label header currently requires a data area.%s: Preparing PV label header %s size %lu with%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%sWARNING: bad metadata header on %s at %llu.Ignoring mda on device %s at offset %luWARNING: bad metadata text on %s in mda%dFound pv_header_extension version %u on %sWARNING: Scanning %s mda1 found mismatch with other metadata.WARNING: Scanning %s mda1 failed to save internal summary.Found metadata seqno %u in mda1 on %sWARNING: Scanning %s mda2 found mismatch with other metadata.WARNING: Scanning %s mda2 failed to save internal summary.Found metadata seqno %u in mda2 on %sWARNING: scanning %s mda2 failed to read metadata summary.WARNING: scanning %s mda1 failed to read metadata summary.struct data_area_list allocation failedstruct mda_list allocation failedCouldn't allocate labeller object.freeseg/freeseg.cFailed to set up async io, using sync io.Failed to set up io layer with %d blocks.scan_dev_close %s no DEV_IN_BCACHE setscan_dev_close %s already closedDevice open %s has DEV_IN_BCACHE already setDevice open %s already open with di %d fd %dDevice open %d:%d has no path names.Can't open %s exclusively. Mounted filesystem?Drop alias for %d:%d failed open %s (%d)Invalid path %s for device %d:%d, trying different path.Scanning %d devices for VG infoProcessing data from device %s %d:%d di %dClear pvid and info for filtered dev %sIgnoring additional label on %s at sector %llu%s: Label for sector %llu found at sector %llu - ignoring.Label checksum incorrect on %s - ignoringFound label at sector %llu on %sClear pvid and info for no lvm header %slabel scan found duplicate PVID %s on %sWARNING: scan failed to get metadata summary from %s PVID %sScanned devices: read errors %d process errors %d failed %dCouldn't allocate memory for labeller list object.Checking fd limit for num_devs %u failed %dChecking fd limit for num_devs %u want %u soft %lld hard %lldSetting fd limit for num_devs %u soft %lld hard %lldWARNING: permission error setting open file limit for scanning %u devices.WARNING: cannot set open file limit for scanning %u devices.Enable full md component check.Filtering devices to scan (nodata)Will scan %d remaining devicesWARNING: metadata may not be usable with current io_memory_size %d KiBWARNING: increase lvm.conf io_memory_size to at least %llu KiBCannot reopen rw device %d:%d with no valid paths di %d fd %d.Cannot reopen rw device %d:%d with no valid name di %d fd %d.Reopen writeable %s uncached fd %d di %dFailed to open writable %s index %d fd noneFailed to open writeable %s index none fd %dFailed to open rw %s errno %d di %d fd %d.Failed to change to rw fd %s di %d fd %d.reopen writeable %s close prev errno %d di %d fd %d.reopen writable %s di %d prev %d fd %dError opening device %s for reading at %llu length %u.Error reading device %s at %llu length %u.Scanning failed to get devices.Set last byte mixed block sizes physical %u logical %u using 512Set last byte mixed block sizes physical %u logical %u using 4096dev_write bcache not set up %sError opening device %s for writing at %llu length %u.Error writing device %s at %llu length %u.Label handler does not support label writesLabel sector %lu beyond range (%ld)%s: Writing label to sector %lu with stored offset %u.dev_set_bytes bcache not set up %sError writing device value %s at %llu length %u.Scanning for labels to wipe from %sFailed to read label from %s sector %llu%s: Wiping label at sector %lluFailed to remove label from %s at sector %llulabel/label.cFailed to set up sync io.close %s errno %drwexrwFailed to set bcache fd.open %s %s di %d fd %dScan failed to open %d:%d %s.Scanning submitted %d readsScan failed to read %s.%s: No lvm label detectedScan failed to process %slabel allocaction failedFinding devices to scanFailed to set up devices.Failed to get device list.close and reopen excl %sclose and reopen rw %sdev_read bcache not set up %sFiltering devices to scanReading labels for pvidclose and reopen to write %sFailed to open device %sFailed to write label to %s/run/lvm/hintslabel/hints.cunlock_hints no existing fdunlock_hints flock errno %dlock_hints existing fd %dlock_hints open errno %d %slock_hints close errno %d %s/run/lvm/newhintsnewhints created/run/lvm/nohintstouch_hints errno %d %stouch_hints close errno %d %sunlink_nohints errno %d %sclear_hints open errno %dunlink_hints errno %d %sclear_hints flush errno %d %sclear_hints close errno %d %sReading hint filehints_version:%d.%dglobal_filter:scan_lvs:devices_file:devs_hash:scan:pvid:devn:%d:%dadd hint %s %s %d:%d %saccept hints found %dread_hint_file close errno %dWriting hint file %d# info: duplicate_pvs # info: duplicate_vgnames # Created by %s pid %d %shints_version: %d.%d global_filter:%s scan_lvs:%d devices_file:%s devices_file:. devs_hash: %u %u unlink_newhints errno %d %sclear_hint_filepvscan_recreate_hints_beginget_hints: pvscan recreateget_hints: nohints filenohints_exist errno %d %snewhints_exist errno %d %sget_hints: newhints fileget_hints: no fileget_hints: lock failget_hints: read failget_hints: needs refreshget_hints: no entries# Created empty by %s pid %d %signore hints with unknown version %d.%dignore hints with version %d.%d current %d.%dignore hints with different global_filterignore hints with different filterignore hints with different or unreadable scan_lvsignore hints with different devices_file: not enabled vs %signore hints with different devices_file: %s vs %signore hints with invalid devs_hashignore hints with read_hash %u count %u calc_hash %u count %uHints not used with duplicate pvsHints not used with duplicate vg namesUncertain hint for unread device %d:%d %sInvalid hint device %d:%d %s pvid %s had hint pvid %sInvalid hint device %d:%d %s pvid %s had vgname %s no VG info.Invalid hint device %d:%d %s pvid %s had vgname %s no PV info.skip hint hash but found label %sexclude md component from hints %sscan:%s pvid:%s devn:%d:%d vg:%s Wrote hint file with devs_hash %u count %uwrite_hint_file close errno %dget_hints: applied using %d other %d vgname %s#global%s/P_%slocking/file_locking.c%s/V_%sToo long locking filename %s/P_%s.Too long locking filename %s/V_%s.Path for locking_dir %s is invalid.locking/locking.cglobal flock already held exFailed to activate %sLVM_SUPPRESS_LOCKING_FAILURE_MESSAGESFile locking initialisation failed.File locking settings: readonly:%d sysinit:%d ignorelockingfailure:%d global/metadata_read_only:%d global/wait_for_locks:%d.Internal error: Resource name %s is too long.Operation prohibited while --readonly is set.Allowing activation with --readonly --sysinit.Operation prohibited while global/metadata_read_only is set.Internal error: Unknown locking mode %s.%H:%M:%S.%06ld LVM_SUPPRESS_SYSLOGfailed to write log file: %s failed to write log file DM_ABORT_ON_INTERNAL_ERRORSInternal error: failed to report cmdstatusCODE_LINE=650CODE_FILE=log/log.c%s%s %s:%d%s%s %s:%d%s%s%s %sstderrdup2dup2(%d, %d) returned %dLVM_LOG_FILE_EPOCH%s_%s_%d_%lluLVM_LOG_FILE_MAX_LINESLVM_EXPECTED_EXIT_STATUSMESSAGE=lvm command %sCODE_LINE=882PRIORITY=%iLVM_CMD_ID=%sLVM_CMD_NAME=%sfatalnoticecmdlabelprocessingvsnprintf failed: skipping external logging function %s:%d %sAborting. Command has reached limit for logged lines (LVM_LOG_FILE_MAX_LINES=%lu).File descriptor %d already open in read-only mode, expected write-only or read-write mode.Can't set standard input for log output.Failed to open stream for file descriptor %d.Failed to allocate buffer for stream on file descriptor %d.Internal error: reopen_standard_stream called on non-standard streamWARNING: Ignoring invalid LVM_LOG_FILE_EPOCH envvar "%s".%d %*s %*c %*d %*d %*d %*d %*d %*u %*u %*u %*u %*u %*u %*u %*d %*d %*d %*d %*d %*d %lluWARNING: Cannot parse content of %s.WARNING: Debug log file path is too long for epoch.WARNING: Ignoring invalid LVM_LOG_MAX_LINES envvar "%s".MESSAGE_ID=3ca432788c374e4ba684b834188eca36Ignoring unrecognized journal value.log_command_vprint_log/proc/self/statsmqmetadata/cache_manip.cUnknown cache mode: %s.another LVCan't convert internal LV %s.Setting chunk size to %s.%s_cpoolFlushing of %s aborted.Use cache metadata format 2.WARNING: Cannot detect default cache policy, using "mq".Default cache policy is not available.Detected default cache_policy "%s".Internal error: Cache pool %s has undefined cache mode, using writethrough instead.Internal error: Cache mode is not determined.Internal error: Cannot set cache mode for non cache volume %s.WARNING: Data redundancy could be lost with writeback caching of raid logical volume!Cannot use chunk size %s with cache pool %s metadata size %s.Minimal size for cache pool %s metadata with chunk size %s would be %s.Cannot use too small chunk size %s with cache pool %s data volume size %s.Maximum configured chunks for a cache pool is %lu.Use smaller cache pool (<%s) or bigger cache chunk size (>=%s) or enable higher values in 'allocation/cache_pool_max_chunks'.Cannot use locked cache pool %s.Logical volume %s is already in use by %s.Cannot use locked origin volume %s.Cache is not supported with %s segment type of the original logical volume %s.Cache chunk size %s is not in the range %s to %s.Cache chunk size %s must be a multiple of %s.Using %s chunk size instead of default %s, so cache pool has less than %lu chunks.Chunk size %s is less than required minimal chunk size %s for a cache pool of %s size and limit %lu chunks.To allow use of more chunks, see setting allocation/cache_pool_max_chunks.Size of %s data volume cannot be smaller than chunk size %s.Preferred pool metadata size %s.Can't prepare new cachepool name for %s.WARNING: Skippping flush for failed cache %s.Flushing %lu blocks for cache %s.WARNING: Dirty blocks found on read-only cache volume %s.Failed to sync local devices when clearing cache volume %s.Failed to sync local devices after final clearing of cache %s.Internal error: LV %s is not cache volume.Internal error: LV %s is already dropped cache volume.Failed to activate %s to flush cache.Internal error: Cannot set cache metadata format for non cache volume %s.Failed to duplicate policy name.WARNING: Cannot detect default cache metadata format, using format: %u.Cache metadata format %u is not supported by kernel target.Detected default cache metadata format: %u.Internal error: Extend size can't be 0.The minimum cache size is two extents (%s bytes).Rounding down metadata size to max size %sRounding up metadata size to min size %sRounding up metadata size to full physical extent %sCache data blocks %llu and chunk size %u exceed max chunks %llu.Use smaller cache, larger --chunksize or increase max chunks setting.Internal error: Missing cache policy name.Setting LV %s cache on %s meta start 0 len %llu data start %llu len %llu sectorsSetting LV %s cache format %u policy %s chunk_size %u sectorsWARNING: thin pool data will not be automatically extended when cached.WARNING: manual splitcache is required before extending thin pool data.Replacing chunk size %s in cache pool %s with chunk size %s from profile.Internal error: Failed to wipe cache pool for volume %s.Aborting. Failed to activate cache pool %s.Aborting. Failed to wipe cache pool %s.Aborting. Could not deactivate cache pool %s.%s=%smetadata/writecache_manip.c%s=%llureporter_poollvol%dflush_on_suspendRemoving previous wcorig %sFailed to deactivate %s.Failed to update VG.Failed to get mem for LV status.Failed to get device mapper status for %sNo device mapper info exists for %sInvalid device mapper status type (%d) for %sLV %s has no suffix for cachevol (skipping rename).Failed to generate new unique name for unused LV %sLV %s segment is not writecache.LV %s writecache segment has no writecache.LV %s writecache segment has no originFailed to set flush_on_suspend in writecache detach %s.Failed to remove seg in writecache detach.Failed to remove lv layer in writecache detach.Failed to write VG in writecache detach.Failed to get lv_committed in writecache detach.Suspending writecache to detach %sFailed to suspend LV in writecache detach.Checking writecache errors to detach.Failed to get writecache error status for %s.Failed to flush writecache (error %u) for %s.Failed to commit VG in writecache detach.Resuming after writecache detached %sFailed to resume LV in writecache detach.Deactivating previous cachevol %sFailed to deactivate previous cachevol in writecache detach.Deactivating previous wcorig %sFailed to deactivate previous wcorig LV in writecache detach.Failed to remove previous wcorig LV in writecache detach.Failed to write and commit VG in writecache detach.Failed to activate LV %s for flushing writecache.Failed to sync local devices before detaching writecache.Failed to flush writecache for %s.Failed to deactivate LV %s for detaching writecache.Failed to set writecache cleaner for %s.Failed to create list of writecache settings.metadata/integrity_manip.cbitmapJ%s_imetalvconvertcrc32cLV update and reload failedFailed to add integrity.lvcreateLV %s segment has no integrity metadata device.LV %s integrity segment has no originextend not needed for imeta LV %sFailed to build list of PVs for extending %s.Failed to extend integrity metadata LV %sLV %s segment is unsupported raid for integrity.Failed to update and reload LV after integrity remove.Failed to deactivate unused iorig LV %s.Failed to deactivate unused imeta LV %s.Failed to remove unused iorig LV %s.Failed to remove unused imeta LV %s.Invalid raid integrity mode (use "bitmap" or "journal")Integrity can only be added to top level raid LV.Integrity cannot be added to snapshot origins.Integrity can only be added to raid1,4,5,6,10.raid image must be linear to add integrityFailed to build list of PVs for %s.Failed to create metadata LV name.Creating integrity metadata LV %s with size %s.Failed to create integrity metadata LVIntegrity metadata uses more than one segment.Failed to activate LV %s to zeroFailed to zero LV for integrity metadata %sFailed to deactivate LV %s after zeroFailed to activate LV to check block size %sIntegrity requires consistent logical block size for LV devices.Invalid integrity block size, possible values are 512, 1024, 2048, 4096Integrity block size %u not allowed with device logical block size 4096.Using integrity block size %u with unknown device logical block size.Path name too long to get LV block size %sCannot use integrity block size %u with unknown file system block size, logical block size %u, physical block size %u.Using integrity block size %u for unknown file system block size, logical block size %u, physical block size %u.Limiting integrity block size to 512 because the LV is active.Using integrity block size %u for file system block size %u.Integrity block size %u cannot be larger than file system block size %u.Failed to deactivate LV after checking block size %sAdding integrity to raid image %sWriting VG and updating LV with new integrity LV %sWriting VG with new integrity LV %sActivating to start integrity initialization for LV %sFailed to activate integrity LV to initialize.Writing VG with initialized integrity LV %sNew integrity metadata LV may require manual removal.Invalid LV type for clearing integrityWARNING: failed to clear integrity recalculate flag for %sunassignedmetadata/lv.c:%u-%u(%u)nopassdownnot monitored%s is %son %slvfullname snprintf faileddm_pool_alloc failedlvpath snprintf faileddm_build_dm_name failedlv_dmpath snprintf failed%s/%s%sreshapeFailed to duplicate hostnameActivating logical volume %s.Thin volume %s is active._format_pvsegs: str_list_create failedInternal error: Unknown area segtype._format_pvseggs: extent range dm_snprintf failed_format_pvsegs: extent number dm_snprintf failed_format_pvsegs: list item dm_pool_zalloc failed_format_pvsegs: list item dmsnprintf failed_format_pvsegs: failed to add item to listInternal error: Bad pvmove structureCannot query non thin-pool segment of LV %s for discards property.Kernel reports unknown discards status %u.lvseg_kernel_discards_dup_with_info_and_seg_status: dm_pool_strdup failed.WARNING: Thin volume %s maps %s while the size is only %s.Internal error: for_each_sub_lv failure.modules str_list allocation failedInternal error: Cannot find mirror segment.Internal error: %s is not a RAID imageFailed to find RAID segment for %s%s on %s is not a RAID segmentInternal error: sub-LV %s was not found in raid segmentInternal error: %s is not of RAID typeInternal error: %s on %s is not a RAID segment.Failed to lock logical volume %s.Deactivating logical volume %s.Failed to unlock logical volume %s.phop(pohpPpp8oFailed to allocate memorymetadata/lv_manip.c %s/%s uses %shistorical Failed to create new nameCannot rename locked LV %s--dry-run--verbose--yes--force merging origin clustered and DISCARD with %u snapshots(s) with snapshot %s (origin only)ConsideringChanging with PV tags: pv_list allocation failedraid0raid4raid5raid5_laraid5_raraid5_lsraid5_rsraid6raid6_zrraid6_nrraid6_ncmultithinoriginthinsnapshotmultiextthinoriginwritecacheoriginintegrityoriginmultithickoriginthicksnapshotpublicStack %s:%u[%u] on LV %s:%u.Internal error: Meta le != 0.Failed to suspend %s.Failed to reactivate %s.metadata areaup to contiguous dm_pool_begin_object faileddm_pool_grow_object failedCling_to_allocated is %sset %u %s%s of %u extents eachSorting %u log areasSorting %u areasphysicallogicalat most Extending %u mirror images.Using default stripesize %sNew size of 0 not permitted.Invalid stripe size %s.Can't resize reshaping LV %s.Live by historical LVCreating logical volume %sLV %s in VG %s is now hidden.Historical lFailed to remove cachevol %s.Failed to deactivate LV %sFailed to update pool %s.Removing snapshot volume %s.lvremovevgremovePostponing write and commit.WARNING: Failed to unlock %s.cache originexternal originVDO poolHistorical Layer segment found: %s:%uLayer is not linear: %s:%uMissing error segtypelv_list alloc failedCan't move snapshot segment.Removing layer %s for %sFailed to find layer %s in %s_mimageCreation of layer LV failedInserting layer %s for %s_mimage_0Inserting %s:%u-%u of %s/%sInterrupted initialization ofFailed to wipe signatures onFailed to initializeInterrupted initialization%s logical volume %s.BLKZEROOUTioctlNo meta_areas for RAID typeFailed to extend %s in %s.Failed to remove LVFailed to commit VG %srimage%s_%s_%u%s_%s%s_rmeta_%uFailed to insert layer for %sReducExtend and openlv_info failed: aborting.Filesystem check failed.Filesystem resize failed.Failed to activate %s.%s: discarding failed.Problem deactivating %s.snapshot exception storestart of new LVAdding integrity to new LVCache pool is prepared.Failed to activate thin %s.Failed to activate new LV %s.Aborting. Failed to wipe %s.%s_voriginCouldn't create snapshot.vpool%dthin-poolvdo-poolLogical volume "%s" created.Cannot rename "%s": name format not recognized for internal LV "%s"Failed to allocate space for new nameCannot rename "%s". New logical volume name "%s" is invalid.%sLogical Volume "%s" already exists in volume group "%s"Couldn't create LV path for %s.Couldn't generate new LV size string.Do you really want to remove%s%s%s%s logical volume %s%s? [y/n]: Logical volume %s not removed.Updating logical volume %s on disk(s)%s.Dropping origin_only for %s as lock holds %sFailed to suspend logical volume %s.Failed to revert logical volume %s.Updating logical volume %s in kernel.Problem reactivating logical volume %s.Rounding size %s (%u extents) %s to stripe boundary size %s (%u extents).WARNING: Ignoring invalid string in config file entry allocation/cling_tag_listWARNING: Ignoring empty string in config file entry allocation/cling_tag_listWARNING: Ignoring string not starting with @ in config file entry allocation/cling_tag_list: %sWARNING: Ignoring empty tag in config file entry allocation/cling_tag_listPV tags string extension failed.Not using free space on %s: Matched allocation PV tag %s on existing parallel PV %s.Matched allocation PV tag %s on existing %s with free space on %s.Eliminating allocation area %u at PV %s start PE %u from consideration: PV tag %s already used.Memory reallocation for parallel areas failed.PV tags string allocation failed.%s allocation area %u %s %s start PE %u length %u leaving %u%s%s.WARNING: Read-only activated logical volume %s not zeroed.WARNING: Logical volume %s not zeroed.Signature wiping on logical volume %s not requested.Failed to find segment for %s extent %uLV layout list allocation failedLV role list allocation failedInternal error: WARNING: Failed to properly detect layout and role for LV %s/%s.Overriding default 'mirror_region_size' setting with 'raid_region_size' setting of %u kiBReducing region size to %u kiB (power of 2).Using default region size %u kiB (multiple of page size).Adding %s:%u as an user of %s.Failed to allocate segment list.%s:%u is no longer a user of %s.Internal error: Segment %s:%u is not a user of %s.Internal error: get_only_segment_using_this_lv() called with NULL LV.%s is expected to have only one segment using it, while %s:%u uses it %d times.%s is expected to have only one segment using it, while it has %d.Internal error: alloc_lv_segment: Missing segtype.Internal error: Try to set to high area number (%u >= %u) for LV %s.Failed to allocate widened LV segment for %s.Refusing refresh of partial LV %s. Use '--activationmode partial' to override.Couldn't allocate new %s segment.allocate_extents does not handle virtual segmentsInternal error: Missing allocatable pvs.Metadata format (%s) does not support required LV segment type (%s).Consider changing the metadata format by running vgconvert.Internal error: _alloc_init called for virtual segment.Internal error: _alloc_init called for non-virtual segment with no disk space.allocation pool creation failedallocation handle allocation failedInternal error: Bad metadata_area_countLog size needs too many extents %lu with region size of %u sectors.Adjusted allocation request to %u logical extents. Existing size %u. New size %u.Mirror log of %u extents of size %u sectors needed for region size %s._allocate called with no work to do!Number of extents requested (%u) needs to be divisible by %u.Parallel PVs at LE %u length %u: %sNot enough PVs with free space available for parallel allocation.Consider --alloc anywhere if desperate.Couldn't allocate areas array.Trying allocation using %s policy.Insufficient free space: %lu extents needed, but only %u available%u preferred area(s) to be filled positionally.Areas to be sorted and filled sequentially.Still need %s%u total extents from %u remaining (%u positional slots): %u (%u data/%u parity) parallel areas of %u extents eachFound %u areas for %u parallel areas and %u log areas so far.Filled %u out of %u preferred areas so far.Not using free space on existing parallel PV %s.Internal error: _alloc_parallel_area called without any allocation to do.alloced_area allocation failedMetadata does not fit on a single PV.Allocating parallel metadata area %u on %s start PE %u length %u.Allocating parallel area %u on %s start PE %u length %u.Insufficient suitable %sallocatable extents for logical volume %s: %u more requiredInsufficient suitable %sallocatable extents found for logical volume %s.Found fewer %sallocatable extents for logical volume %s than requested: using %u extents (reduced by %u).Insufficient free space for log allocation for logical volume %s.Missing segtype in lv_add_segment().lv_add_segment cannot handle virtual segmentsLog segments can only be added to an empty LVCouldn't allocate new LV segment.Couldn't merge segments after extending logical volume.Generating list of PVs that %s/%s uses:Rounding size to boundary between physical extents: %s.Reducing %u%%VG to remaining free space %s in VG.Specified LV does not have an origin LV.Internal error: Unsupported percent type %u.Converted %u%%%s into %s%u %s extents.VolumeType does not match (%s).Logical volume %s is using mixing segment types %s and %s.Cannot vary number of mirrors in LV yet.Internal error: Missing mirror segments for %s.Please specify number of stripes (-i) and stripesize (-I)Unable to extend "%s" segment type with different number of stripes.Using stripesize of last segment %sStripesize for striped segment should not be 0!Increasing incremention size from %s to %s to fit new VDO slab.Unable to extend %s by %u logical extents: exceeds limit (%u).Reached maximum COW size %s (%u extents).Reached maximum pool metadata size %s (%u extents).Thin pool will use metadata without cropping.Ignoring stripes, stripesize and mirrors arguments when reducing.Unable to reduce %s below 1 extent.New size (%d extents) matches existing size (%d extents).Rounding size (%d extents) up to stripe boundary size for segment (%d extents).Rounding size (%d extents) down to stripe boundary size for segment (%d extents)New size given (%d extents) not larger than existing size (%d extents)New size given (%d extents) not less than existing size (%d extents)New size (%d extents) matches existing size (%d extents)New size for %s: %u. Existing logical extents: %u / physical extents: %u.Snapshot origin volumes cannot be reduced in size yet.Snapshot origin volumes can be resized only while inactive: try lvchange -an.Thin pool volumes %s cannot be reduced in size yet.Thin pool metadata volumes cannot be reduced.Cannot reduce VDO pool data volume %s.Reduce not yet allowed on LVs with writecache attached.Support for online metadata resize of %s not detected.Thin target does not support external origin smaller then thin volume.Failed to allocate generic logical volume structure.Failed to allocate generic logical volume list item.Failed to allocate generic volume list item for indirect glv %sInternal error: %s logical volume %s is not a user of %s.Internal error: historical_glv_remove: historical LV %s/-%s not found Historical LV %s/-%s already on removed list Removing historical connection between %s and %s.Unable to allocate logical volume structureFailed to generate unique name for the new logical volumeUnable to create LV %s in Volume Group %s: name already in use%s.parallel_areas allocation failedLV %s in VG %s is now visible.Dropping snapshot merge of %s to removed origin %s.Dropping snapshot merge of removed %s to origin %s.Internal error: Pool size mismatched data size for %sSegment extent reduction %u not divisible by #stripes %uUnable to deactivate spare logical volume %s.Internal error: Removing still active LV %s.Can't remove logical volume %s under snapshot.Can't remove external origin logical volume %s.Can't remove logical volume %s used by a mirror.Can't remove logical volume %s used as mirror log.Can't remove logical volume %s used as RAID device.Can't remove logical volume %s used by a pool.Internal error: Thin LV %s without pool.Can't remove locked logical volume %s.Failed to detach writecache from %sIgnoring update failure of pool %s.Error releasing logical volume %s with pending delete.Unable to deactivate logical volume %s.Detach cachevol before removing.Releasing %slogical volume "%s"Error releasing %slogical volume "%s"%sogical volume "%s" successfully removed.Failed to obtain merging snapshot progress percentage for logical volume %s.Can't remove merging snapshot logical volume %s.Removing snapshot %s that failed to merge may leave origin %s inconsistent. Proceed? [y/n]: Removing origin logical volume %s with %u snapshots(s).Removing merging origin logical volume %s.Unable to remove %s, volume is merged to %s.Unable to fully deactivate unused cache-pool %s.Removal of pool metadata spare logical volume %s disables automatic recovery attempts after damage to a thin or cache pool. Proceed? [y/n]: Removing %s %s will remove %u dependent volume(s). Proceed? [y/n]: Remove %s:%u[%u] from the top of LV %s:%u.Failed to unlock vdo pool in lvmlockd.Can't convert non-striped segment to mirrored.Can't convert striped segment with multiple areas to mirrored.Couldn't allocate converted LV segment.Internal error: Mirror layer must be inserted before adding mirrors.Conflicting region_size %u != %u.Failed to find segment for %s extent %u.Failed to split segment at %s extent %u.Cannot rename internal LV "%s".Cannot rename active VDOPOOL volume %s, VDO target feature support is missing.Failed to allocate space for new name.Failed to generate unique name for unused logical volume.Incompatible layer boundary: %s:%u[%u] on %s:%u.layer segment for %s:%u not found.Removing layer %s for segments of %sLayer status does not match: %s:%u status: 0x%lx/0x%lxLayer boundary mismatch: %s:%u-%u on %s:%u / %u-%u / Internal error: Wrong layer %s in %sInvalid %d segments in %s, expected only 1.Invalid %d area count(s) in %s, expected only 1.Invalid seg_type %d in %s, expected LV.Layer doesn't match segment in %s.Inconsistent extent count (%u != %u) of layer %s.Layered name is too long. Please use shorter LV name.Creating transient LV %s for mirror conversion in VG %s.Creation of transient LV %s for mirror conversion in VG %s failed.Aborting. Unable to tag transient mirror layer.Failed to write intermediate VG %s metadata for mirror conversion.Failed to commit intermediate VG %s metadata for mirror conversion.Failed to resume transient LV %s for mirror conversion in VG %s.Internal error: Non-pvmove LV, %s, passed as argument.Internal error: Bad segment type for first segment area.Failed to build pvmove LV-type mirror %s.Inserting layer %s for segments of %s on %sMatched PE range %s:%u-%u against %s %u len %uFailed to insert segment in layer LV %s under %s:%u-%uVolume %s is not active locally (volume_list activation filter?).Failed to sync local devices before wiping volume %s.Name too long - device not cleared (%s)%s: not found: device not clearedFailed to open %s for wiping and zeroing.Wiping known signatures on logical volume %s.Metadata logical volume %s will be fully zeroed.Initializing %s of logical volume %s with value %d.%s logical volume %s at position %lu and size %lu.%s logical volume %s with value %d and size %s.Metadata logical volume %s not fully zeroed and may contain stale data.Internal error: Empty list of LVs given for wiping.Internal error: LVs must be set visible before wiping.Failed to activate localy %s for wiping.Failed to sync local device names after deactivation of wiped volumes.Aborting. Failed to extend %s in %s.Failed to copy tags onto LV %s to clear metadata.Test mode: Skipping wiping of metadata areas.Adding segment of type %s to LV %s.Internal error: Non-empty LV passed to _lv_insert_empty_sublvFailed to create mapping segment for %s.Failed to create sub LV name for LV %s.Unable to read sync percent while LV %s is not locally active.Do full resync of extended portion of %s? [y/n]: Failed to get sync percent for %s.Skipping initial resync for extended portion of %sLV %s cannot be extended while it is recovering.%sing logical volume %s to %s%sSize of logical volume %s unchanged from %s (%u extents).Size of logical volume %s changed from %s (%u extents) to %s (%u extents).Policy-based resize is supported only for snapshot, thin pool and vdo pool volumes.WARNING: Thin pool autoextend threshold %d%% is set below minimum supported 50%%.WARNING: VDO pool autoextend threshold %d%% is set below minimum supported 50%%.WARNING: Snapshot autoextend threshold %d%% is set bellow minimal supported value 50%%.Can't extend %s with %s autoextend percent set to 0%%.Can't read state of locally inactive LV %s.--poolmetadatasize can be used only with thin pools.--poolmetadatasize for thin-pool metadata cannot be used with size.Internal error: No single component user of logical volume %s.Cannot resize external origin logical volume %s.Cannot resize a RAID %s directlyCannot resize logical volume %s while it is tracking a split image.Cannot resize %s LV %s. Convert to more stripes first.RAID module does not support shrinking.Can't resize internal logical volume %s.Can't resize locked logical volume %s.Can't resize logical volume %s while lvconvert in progress.Varied stripesize not supported. Ignoring.Stripe size cannot be larger than %s.Reducing stripe size %s to maximum, physical extent size %s.Stripe size must be power of 2.Ignoring --resizefs as volume %s does not have a filesystem.Varied striping not supported. Ignoring.Mirrors not supported. Ignoring.Cannot resize logical volume %s with active component LV(s).Cannot reduce LV with integrity.Also going to resize thin-pool metadata to match bigger data.Ignoring PVs on command line when reducing.Logical volume %s must be activated before resizing filesystem.Logical volume %s must be activated before reducing device size.WARNING: Reducing active%s logical volume to %s.THIS MAY DESTROY YOUR DATA (filesystem etc.)Do you really want to reduce %s? [y/n]: Logical volume %s NOT reduced.Cannot resize %s without using device-mapper kernel driver.Name too long - device not discarded (%s)%s: not found: device not discarded.%s: max bytes and granularity query fails.WARNING: %s: Discarding %s at offset %lu, please wait...Logical volume %s successfully resized.Failed to sync local devices before deactivating LV %s.ACTIVATION_SKIP flag set for LV %s/%s, skipping activation.Maximum number of logical volumes (%u) reached in volume group %sMetadata does not support %s segments.Volume group %s does not support tags.Metadata only supports readahead values between 2 and 120.Stripe size may not exceed %s.Can't create %s without using device-mapper kernel driver.WARNING: Skipping zeroing and wipping, compiled without activation support.The extent size in volume group %s is too small to support striped RAID volumes.Reducing requested stripe size %s to maximum, physical extent size %s.Internal error: Unable to create new logical volume with no extents.Unable to create %s smaller than 1 chunk.Number of stripes (%u) must not exceed number of physical volumes (%d)Internal error: Cannot create %s volume without %s pool.Couldn't find volume %s in Volume group %s.Cannot use locked pool volume %s.Rounding size (%d extents) up to chunk boundary size (%d extents).Aborting. Failed to locally activate thin pool %s.Cannot create new thin volume, free space in thin pool %s reached threshold.Origin volume %s not found in Volume group %s.Caching of origin cache volume smaller then chunk size is unsupported.Internal error: Pool LV for cache is missing.Logical volume %s is not a cache pool.WARNING: New %s won't be synchronised. Don't read what you didn't write!Logical volume %s is not a thin pool.Snapshots of locked devices are not supported.Cannot use writable LV as the external origin.Cannot use active LV for the external origin.Couldn't find origin volume '%s'.Can't share virtual origins. Use --virtualsize.Virtual size matching available free logical size in VDO pool.Volume group "%s" has insufficient free space (%u extents): %u required.Setting read ahead sectors %u.Setting device number to (%d, %d).Test mode: Skipping activation, zeroing and signature wiping.Aborting. Failed to activate LV %s.Aborting. Failed to activate LV %s locally exclusively.Failed to suspend thin snapshot origin %s.Aborting. Failed to read transaction_id from thin pool %s.WARNING: Metadata for thin pool %s have transaction_id %lu, but active pool has %lu.Restoring previous transaction_id %lu for thin pool %s.Failed to activate thin pool %s.Cannot activate thin pool %s, perhaps skipped in lvm.conf volume_list?Failed to deactivate thin pool %s.Aborting. Failed to activate snapshot exception store.Aborting. Failed to activate temporary volume for VDO pool creation.Aborting. Couldn't deactivate VDO LV %s with skipped activation.Aborting. Leaving cache pool %s and uncached origin volume %s.Reverting created caching layer.LV %s has no suffix for cachepool (skipping rename).Aborting. Couldn't deactivate snapshot COW area %s.Failed to sync local devices before creating snapshot using %s.Zero segment type for virtual origin not foundVirtual origin name is too long.Failed to activate sparce volume %s.Aborting. Manual intervention required.Failed to sync local devices before reverting %s.Unable to deactivate failed new LV %s. Manual intervention required.Manual intervention may be required to remove abandoned LV(s) before retrying.Failed to resume thin snapshot origin %s.Internal error: Unsupported creation of cache and cache pool volume.Internal error: Logical volume is not cache %s.Logical volume %s is now cached.Internal error: Creation of pool for unsupported segment type %s.Temporary logical volume "%s" created.$|Dl_tdata_cdata_corig_wcorig_vdata_tdata_cdata_corig_wcorig_vdataLV %s invalid: %s for %s segmentLV %s invalid: %s (is %u) for %s segmentmin recovery larger than max recoveryLV %s invalid: segment %u is referencing different LV.LV %s invalid: segment %u should begin at LE %u (found %u).LV %s: segment %u with len=%u has inconsistent area_len %uLV %s: segment %u has same LV %s for both origin and snapshotLV %s, segment %u invalid: %s for %s segment.is not referencing cache pool LVhas invalid cache metadata formathas invalid cache's feature flagis missing METADATA_FORMAT flagdoes not support flag ERROR_WHEN_FULL.log LV does not point back to mirror segmentregion size is bigger then LV itselflog LV is not a mirror log or a RAID imageLV %s invalid: maximum supported areas %u (is %u) for %s segmentDataLV without RAID image flagMetaLV without RAID metadata flagdata LV does not refer back to pool LVmetadata LV does not refer back to pool LVmust not have pool metadata LV setis not flagged as thin pool LVis a thin volume that must not contain thin pool segmentis not flagged as thin volume LVis a thin pool that must not contain thin volume segmentis not referencing thin pool LVexternal LV is not flagged as a external origin LVmerge LV is not flagged as a thin LVmerge LV is not flagged as mergingis not referencing VDO pool LVLV %s: segment %u has unassigned area %u.LV %s: segment %u has inconsistent PV area %uLV %s: segment %u has inconsistent LV area %uLV %s: segment %u mirror image %u missing mirror ptrLV %s segment %u uses LV %s, but missing ptr from %s to %sLV %s has duplicated links to LV %s segment %uLV %s: mirrored LV segment %u has wrong size %u (should be %u).LV %s: inconsistent LE count %u != %uLV %s is used by LV %s:%u-%u, but missing ptr from %s to %sReference count mismatch: LV %s has %u links to LV %s:%u-%u, which has %u linksLV %s is indirectly used by historical LV %sbut that historical LV does not point back to LV %sLV %s is indirectly used by LV %sbut that LV does not point back to LV %sLV %s must have exactly one segment.LV %s: segment 1 pool data LV does not point back to same LVLV %s: thin pool metadata LV does not use _tmeta.LV %s: cache pool metadata LV does not use _cmeta.LV %s: external origin count does not match.LV %s: external origin cant't be writable.LV segment %s:%u-%u is incorrectly listed as being used by LV %sSegment with extent %u in LV %s not foundUnable to split the %s segment at LE %u in LV %sCouldn't allocate cloned LV segment.LV segment tags duplication failedSplit %s:%u[%u] at %u: %s LE %uSplit %s:%u[%u] at %u: %s PE %uUnassigned area %u found in segmentmetadata/merge.cnon power of 2 region sizemirror image is not mirroredis not flagged as cache LVis missing cache pool LVsets cleaner_policyis missing cache policy namehas invalid chunk size.sets METADATA_FORMAT flagsets cache metadata formatsets cache modesets policy namesets policy settingslog LV is not a mirror logregion size is zero_mlogregion size is non power of 2zero area countzero areasextents_copied too largenon-zero origin LVnon-zero cow LVnon-zero origin_listno DataLVDataLV size variationsno MetaLVMetaLV size variationsno meta areasnon power of 2 stripe sizenon-zero region_sizenon-zero write behindnon-zero min recovery ratenon-zero max recovery ratenon-zero stripe sizeminimum 2 areas requiredminimum 5 areas requiredminimum 4 areas requirednon-zero writebehindbogus RAID segment typeno raid image SubLVvisible raid image LVno raid meta SubLVvisible raid meta LVis missing a pool data LVis missing a pool metadata LVzero_new_blocks is invalidsets zero_new_blockssets discardssets thin_messages listsets CROP_METADATA flagis missing thin pool LVhas too large device idsets device_idsets external LVsets merge LVsets indirect_origin LVis not flagged as VDO pool LVis missing a VDO pool data LVis not VDO pool data LVsets invalid VDO parameter(s)sets vdo_pool_header_sizesets vdo_pool_virtual_extentssets vdo_paramsis not flagged as VDO LVis missing VDO pool LVsets pool LVsets chunk_sizesets transaction_idset segtype_privateLV %s: has no segment._cmetametadata/metadata.csnprintf random bit failed.Skipping clustered VG %s.Failed to add tag %s to %s/%s2.4.#orphansvg_remove_mdas %s failed%s: Couldn't get size.Volume group %s is read-onlyformat_instanceAdding PVs to VG %s.Adding PV %s to VG %s.PV %s has wrong block size.pv allocation failedvg_createFailed to hash mda.SettingClearingignoredin-useFailed to allocate pvid hash.Failed to hash pvid.Failed to allocate uuid hashFailed to hash lvname.Failed to hash lvid.Failed to write VG %s.LV %s dev %s is pmem.LV %s dev %s not pmem.LV %s on pmemnaReading orphan VG %s.Can't get lock for %s.VG name not found for vgid %sVolume group "%s" not foundRescanning devices for %s %sVolume group "%s" not found.Reading VG %s without a lock.Volume group %s is exportedVolume group %s is read-only.Failed to import written VG.vg_devs_checkReading VG %s %sInternal error: Referenced LV %s not listed in VG %s.Internal error: Referenced PV %s not listed in VG %s.Internal error: Invalid character at index %u of lock_args "%s"Internal error: Invalid colon at index %u of lock_args "%s"Failed to allocate bitset for setting random bits.dm_pool_begin_object failed for random list of bits.Failed to generate list of random bits.Failed to finish list of random bits.Selected %u random bits from %u: %sFailed to allocate pv structure.Allowing forced access to clustered vg %sUsing metadata size 960 KiB for non-standard page size %d.Requested PE alignment is %llu sectorsStandard PE alignment is %llu sectorsIncreasing PE alignment to page size %u sectorsAdjusting PE alignment from %llu sectors to md stripe width %llu sectors for %sAdjusting PE alignment from %llu sectors to mininum io size %llu sectors for %sAdjusting PE alignment from %llu sectors to optimal io size %llu sectors for %sSetting PE alignment to %llu sectors for %s.Setting PE alignment offset to %llu sectors for %s.New volume group name "%s" is invalid.%s: already exists in filesystemNew volume group path exceeds maximum length of %d!Old and new volume group names must differvg->name allocation failed for '%s'pv->vg_name allocation failed for '%s'Marking PV %s as moved to VG %sPhysical extent size used for volume group %s is less than logical block size (%u bytes) that %s uses.Logical volume %s/%s does not support tagsFailed to duplicate tag %s from %s/%sVolume group %s does not support tagsFailed to duplicate tag %s from %sFailed to add tag %s to volume group %sMajor number %d outside range 0-255.Minor number %d outside range 0-255.Major number %d outside range 0-4095.Ignoring supplied major %d number - kernel assigns major numbers dynamically.Minor number %d outside range 0-1048575.Volume Group allocation policy cannot inherit from anythingPhysical extent size may not be zeroNumber of volumes may not exceed 255Rounding up size to full physical extent %sVolume too large (%s) for extent size %s. Upper limit is less than %s.Specified size is smaller then physical extent boundary.No free extents in the list of physical volumes.No free extents in Volume group %s.Converted %s%%%s into 0 extents.Converted %s%%%s into %u extents.Internal error: Read ahead data missing.Logical volumes in "%s" must be inactiveExtent sizes differ: %d (%s) and %d (%s)Maximum number of physical volumes (%d) exceeded for "%s" and "%s"Maximum number of logical volumes (%d) exceeded for "%s" and "%s"Metadata types differ for "%s" and "%s"Duplicate logical volume name "%s" in "%s" and "%s"Physical volume %s might be constructed from same volume group %s.Calculated readahead of LV %s is %uVolume group "%s" not found, is inconsistent or has PVs missing.Consider vgreduce --removemissing if metadata is inconsistent.Volume group "%s" still contains %u logical volume(s)WARNING: Device %s has size of %lu sectors which is smaller than corresponding PV size of %lu sectors. Was device resized?Format does not support writing physical volumesAssertion failed: can't _pv_write non-orphan PV (in VG %s)Removing physical volume "%s" from volume group "%s"Failed to remove physical volume "%s" from volume group "%s"Volume group "%s" successfully removedVolume group "%s" not properly removedFailed to clear metadata from physical volume "%s" after removal from "%s"Attempt to modify a read-only VGVolume group %s is not resizeable.Couldn't allocate format_instance object.Adding physical volume '%s' to volume group '%s'pv_list allocation for '%s' failedPhysical volume '%s' is already in volume group '%s'PV %s is used by a VG but its metadata is missing.Physical volume %s is of different format type (%s)Physical volume %s might be constructed from same volume group %sFormat-specific setup of physical volume '%s' failed.Physical volume '%s (%s)' already in the VG.No space for '%s' - volume group '%s' holds max %d physical volume(s).Unable to add %s to %s: new extent count (%lu) exceeds limit (%u).WARNING: PV %s has unknown block size.Devices have inconsistent block sizes (%u and %u)Devices have inconsistent logical block sizes (%u and %u).PV %s cannot be added to VG %s.Failed to create random uuid for %s.WARNING: %s: Overriding real size. You could lose data.%s: Pretending size is %lu sectors.%s: Size must exceed minimum of %lu sectors.pv_list allocation in pv_create failedFormat-specific initialisation of physical volume %s failed.Failed to add metadata area for new physical volume %sPhysical volume %s not in volume group %sLogical volume %s not in volume group %sCannot move PV(s) from non resize volume group %s.Cannot move PV(s) to non resize volume group %s.Failed to read existing physical volume '%s'WARNING: PV %s is marked in use but no VG was found using it.WARNING: PV %s might need repairing.Couldn't create uuid for volume group '%s'.Failed to create format instanceFormat specific setup of volume group '%s' failed.metadata_area allocation failed%s ignored flag for mda %s at offset %lu.Adjusting ignored mdas for %s: %u of %u mdas in use but %u required. Changing %u mda.Internal error: Unable to find %u metadata areas to unignore on volume group %sMetadata areas on physical volume "%s" already ignored.Metadata areas on physical volume "%s" already marked as in-use.Physical volume "%s" has no metadata areas.Marking metadata areas on physical volume "%s" as %s.WARNING: Changing preferred number of copies of VG %s metadata from %u to %uInternal error: LV %s (UUID %s) not found in committed metadata.Internal error: VG %s allocation policy set to invalid cling_by_tags.Internal error: VG %s has external flag LVM_WRITE_LOCKED set internally.Internal error: VG %s tag %s has invalid form.Internal error: PV list corruption detected in VG %s.Internal error: VG %s PV list entry points to different VG %s.Internal error: VG name for PV %s is corrupted.Internal error: Duplicate PV id %s detected for %s in %s.Internal error: PV %s tag %s has invalid form.Internal error: PV segments corrupted in %s.Internal error: LV %s is not marked as removed while it's part of removed LV list for VG %sInternal error: LV %s is marked as removed while it's still part of the VG %sInternal error: LV %s has external flag LVM_WRITE_LOCKED set internally.Internal error: LV name "%s/%s" length %zu is not supported.Internal error: LV %s has VG UUID %s but its VG %s has UUID %sInternal error: LV %s is extra pool metadata spare volume. %u found but only 1 allowed.Internal error: LV %s is not the VG's pool metadata spare volume.Internal error: LV segments corrupted in %s.Internal error: LV %s allocation policy set to invalid cling_by_tags.Internal error: LV name %s has invalid form.Internal error: LV %s tag %s has invalid form.Internal error: #LVs (%u) != #visible LVs (%u) + #snapshots (%u) + #internal LVs (%u) in VG %sFailed to allocate lv_name hashInternal error: Duplicate LV name %s detected in %s.Internal error: Duplicate LV id %s detected for %s in %s.Internal error: Segment in %s is not 2-way.Internal error: Segment in %s has wrong number of areas: %d.Internal error: Volume group %s has limited PV/LV count but limit is not set.Internal error: VG references non pool metadata spare LV %s.Failed to allocate lv_lock_args hashInternal error: VG %s with lock_type %s without lock_argsInternal error: VG %s with lock_type %s is clusteredInternal error: VG %s with lock_type %s has system_id %sInternal error: VG %s has unknown lock_type %sInternal error: VG %s has invalid lock_args charsInternal error: VG %s has lock_args %s without lock_typeInternal error: LV %s/%s has invalid lock_args charsInternal error: LV %s/%s has invalid lock_args "%s"Internal error: LV %s/%s has duplicate lock_args %s.lock_args will be ignored on cache volInternal error: LV %s/%s shouldn't have lock_argsInternal error: LV %s/%s with no lock_type has lock_args %sInternal error: LV %s/%s appearing in VG's historical list is not a historical LVInternal error: Historical LV %s points to different VG %s while it is listed in VG %sInternal error: Historical LV %s has VG UUID %s but its VG %s has UUID %sInternal error: Duplicate historical LV id %s detected for %s in %sInternal error: Duplicate historical LV name %s detected in %sFailed to hash historical LV nameFailed to hash historical LV idInternal error: Name %s appears as live and historical LV at the same time in VG %sInternal error: Historical LV %s is not part of any LV chain in VG %sCannot allocate lock for new LV.Automatically removing historical logical volume %s/%s%s.Failed to handle historical LVs in VG %s.Cannot update partial volume group %s.Cannot update volume group %s while physical volumes are missing.Cannot update volume group %s with duplicate PV devices.Cannot update volume group %s with unknown segments in it!Internal error: Unable to find %u metadata areas to ignore on volume group %sAborting vg_write: No metadata areas to write to!WARNING: wiping mda on outdated PV %sWARNING: failed to wipe mda on outdated PV %s_wipe_outdated_pvs no label for %sWARNING: wiping header on outdated PV %sWARNING: failed to wipe header on outdated PV %sInternal error: Writing metadata in critical section.WARNING: updating PV header on %s for VG %s.WARNING: updating old metadata to %u on %s for VG %s.Format does not support writing volume group metadata areas.WARNING: Failed to write an MDA of VG %s.Failed to destroy record about historical LV %s/%s.Outdated record for historical logical volume "%s" automatically destroyed.Invalid mix of cache device types in %s.WARNING: Couldn't find device with uuid %s.Couldn't find device with uuid %s.WARNING: VG %s was previously updated while PV %s was missing.Found a previously MISSING PV %s with no MDAs.Fixing up missing size (%s) for PV %sWARNING: Physical Volume %s is too large for underlying deviceWARNING: not repairing bad metadata (0x%x) for mda%d on %sWARNING: repairing bad metadata (0x%x) in mda%d at %llu on %s.WARNING: failed to write VG %s metadata to bad mda%d at %llu on %s.WARNING: failed to precommit VG %s metadata to bad mda%d at %llu on %s.WARNING: failed to commit VG %s metadata to bad mda%d at %llu on %s.Volume group name "%s" has invalid characters.WARNING: activating multiple VGs with the same name is dangerous and may fail.Rescan for text mismatch - no mdas.Rescan for text mismatch - no mda dev.Rescan for text mismatch - cannot invalidate.Rescan for text mismatch - no mda header.Rescan for text mismatch - bad_fields.Rescan for text checksum mismatch - now %x prev %x.Rescan for text offset mismatch - now %llu prev %llu.Rescan skipped - unchanged offset %llu checksum %x.Ignoring metadata for VG %s from missing dev.Reading VG %s metadata from %s %lluWARNING: Reading VG %s on %s failed.WARNING: ignoring metadata seqno %u on %s for seqno %u on %s for VG %s.WARNING: Inconsistent metadata found for VG %s.See vgck --updatemetadata to correct inconsistency.VG %s not found on any remaining devices.vg_read %s ignore mda for outdated dev %sWARNING: PV %s in VG %s is using an old PV header, modify the VG to update.WARNING: PV %s in VG %s is missing the used flag in PV header.WARNING: failed to strip outdated historical lvs.VG %s is missing PV %s (last written to %s)WARNING: VG %s is missing PV %s (last written to %s).WARNING: VG %s is missing PV %s.WARNING: VG %s has unused reappeared PV %s %s.WARNING: VG %s was missing PV %s %s.WARNING: One or more devices used as PVs in VG %s have changed sizes.WARNING: Couldn't find all devices for LV %s while checking used and assumed devices.WARNING: Device mismatch detected for %s which is accessing %s instead of %s.Cannot access VG %s with lock type %s that requires lvmlockd.Cannot access VG %s due to failed lock.Test mode is not yet supported with lock type %s.WARNING: Found LVs active in VG %s with foreign system ID %s. Possible data corruption.Cannot access VG %s with system ID %s with unknown local system ID.Cannot access VG %s with system ID %s with local system ID %s.Cannot change VG %s while PVs are missing.See vgreduce --removemissing and vgextend --restoremissing.Cannot change VG %s with unknown segments in it!WARNING: vg_read no vg copy: pool locked.WARNING: vg_read no vg copy: copy exists.WARNING: vg_read no vg copy: pre copy exists.Internal error: Missing committed config tree.Internal error: vg_read vg %p vg_precommitted %pInternal error: vg_read vg %p vg_committed %pTmetadata/mirror.c_mimage_%d%s_mimage_%%dAborting. Unable to tag._mlogtmp_%dFailed to create mirror log.Failed to form mirrored log.LV %s assigned to be split.Unable to allocate memory.lvs list alloc failed. and no log volumeFailed to add mirror images.All mimages of %s are gone.%u image(s) removed from %s.coreFailed to convert mirror logNo conversion is requested.Not a mirror segment.Device path name too long - log header not written (%s).Writing log header for LV %s to device %s.%s: not found: log header not written.Failed to open %s/%s to write log header.Failed to write log header to %s.Failed to build new mirror image name for %s.Aborting. Failed to create mirror image LV. Remove new LV and retry.Failed to add mirror image segment to %s. Remove new LV and retry.Aborting. Failed to add mirror image segment to %s. Remove new LV and retry.Aborting. Failed to add mirror segment. Remove new LV and retry.Unable to determine mirror sync status of %s.Intermediate VG commit for orphan volume failed.Failed to sync local devices when reactivating %s.Internal error: Log LV %s is not top level LV for initialization.Test mode: Skipping mirror log initialisation.Aborting. Unable to create in-sync mirror log while activation is disabled.Aborting. Unable to tag mirror log.Aborting. Failed to activate mirror log.Aborting. Failed to wipe mirror log.Aborting. Failed to write mirror log header.Aborting. Failed to deactivate mirror log. Manual intervention required.Aborting. Failed to sync local devices before initialising mirror log %s.Unable to deactivate mirror log LV. Manual intervention required.Manual intervention may be required to remove abandoned log LV before retrying.Manual intervention may be required to remove/restore abandoned log LV before retrying.Failed to build new mirror log name for %s.Adjusting region_size to %s for mirrored log.Failed to initialise mirror log.Failed to find mirror_seg for %sLV %s on %s is not a mirror segments.Using reduced mirror region size of %sUnable to allocate mirror extents for %s.Failed to add mirror areas to %s.Internal error: Unknown mirror flag.Invalid index (%u) of mirror image supplied to shift_mirror_images().Unable to split non-mirrored LV %s.Internal error: split_count is zero!Detaching %d images from mirror %s.Insufficient removable PVs given to satisfy request.Unable to rename newly split LV.Failed to build new mirror, %s.Failed to build new image name for %s.Failed to generate new image names for %s.Failed to group split images into new mirror.Failed to rename newly split LV in the kernelSegment is not mirrored: %s:%uSegment status does not match: %s:%u status:0x%lx/0x%lxReducing mirror set %s from %u to %u image(s)%s.Incompatible parameters to _remove_mirror_images.Internal error: _remove_mirror_images called incorrectly with is_removable undefined.Unable to remove primary mirror image while mirror volume %s is not in-sync.%s being removed due to failures.Failed error target substitution for %s.Failed to initialize log device %s.No mirror images found using specified PVs.%u images are removed out of requested %u.Multiple-segment mirror is not supported.Unable to determine mirror sync status.Full resync required to convert inactive mirror volume %s to core log. Proceed? [y/n]: Logical volume %s NOT converted.Failed to find mirrored LV for %s.Not collapsing %s: out-of-sync.Failed to release mirror imagesUnable to allocate extents for mirror log.Mirror %s already has a %s log.Log type "mirrored" creation/conversion is not supported for regular operation!Log type "mirrored" is DEPRECATED. Use RAID1 LV or disk log instead.%s: Required device-mapper target(s) not detected in your kernel.Unable to allocate extents for mirror(s).Persistent log is not supported on segment-by-segment mirroring.Striped-mirroring is not supported on segment-by-segment mirroring.Unsupported mirror conversion type.%sLogical Volume "%s" already exists in volume group "%s".Unable to split mirror %s that is not in-sync.Removing more than existing: %d <= %d.Mirror log type "%s" is unknown.Internal error: Unknown mirror log count %d.Internal error: Unable to attach pool metadata LV to %s segtype.Internal error: Logical volume %s is not valid pool.Internal error: Unable to attach pool data LV to %s segtype.Internal error: Unable to attach pool to %s/%s that is not cache or thin volume.Internal error: No pool associated with %s LV, %s.Internal error: Cannot detach pool from LV %s.Internal error: Trying to delete %u again.Internal error: Unsupported message type %u.Initialization of historical LV representation for removed logical volume %s failed.Failed to create historical LV representation for removed logical volume %s.%s is referenced by more then one segments (%s, %s).Pool segment not found for %s.%s on %s is not a %s pool segmentInternal error: %s is not a pool logical volume.No usable device hint found while recalculating pool chunk size for %s.Calculated chunk size %s for pool %s is out of allowed range (%s-%s).Updating chunk size %s for pool %s to %s.Internal error: Pool %s already has extents.Name of logical volume %s is too long to be a pool name.WARNING: Pool %s is created without initialization.Aborting. Failed to activate pool metadata %s.Aborting. Failed to wipe pool metadata %s.Aborting. Could not deactivate pool metadata %s.Size %s of pool metadata volume %s is bigger then maximum usable size %s.Reducing pool metadata size %s to maximum usable size %s.Can't use volume %s with size %s as pool metadata. Minimal required size is %s.Extending pool metadata size %s to required minimal size %s.Internal error: LV %s is not pool metadata spare.Internal error: LV %s has no suffix for pool metadata spare.Failed to generate unique name for pool metadata spare logical volume.Renaming existing pool metadata spare logical volume "%s" to "%s/%s".Can't create pool metadata spare. Name of pool LV %s is too long.Renaming %s as pool metadata spare volume %s.Preparing pool metadata spare volume for Volume group %s.Unable to deactivate pool metadata spare LV. Manual intervention required.WARNING: recovery of pools without pool metadata spare LV is not automated.Dropping unused pool metadata spare LV %s.metadata/pool_manip.cDiscarding message for LV %s._cdata_tdata%s_pmsparemetadata/pv.cCannot disable all metadata areas in volume group %s.Internal error: PV %s unexpectedly not in cache.Adding PE range: start PE %u length %u on %s.Overlapping PE ranges specified (%u-%u, %u-%u) on %s.Failed to create PV entry for missing device.WARNING: Physical volume %s not allocatable.WARNING: Physical volume %s is missing.WARNING: No free extents on physical volume "%s".Unable to allocate physical volume list.Allocation of pe_ranges list failed.PE range error: start extent %u to end extent %u.Physical extent parsing error at %s.Physical Volume "%s" not found in Volume Group "%s".No specified PVs have space available.metadata/pv_list.cAllocation of list failed.Skipping invalid tag %s.Failed to clone PV name.pv_segment allocation failedmetadata/pv_manip.c%s %u: %6u %6u: %s(%u:%u)Gap in pvsegs: %u, %uWrong lvseg area typeInconsistent pvseg pointersInconsistent length: %u %uUpdating physical volume "%s"Physical volume "%s" changedSegment with extent %u in PV %s not foundMissing PV segment on %s at %u.discard_pv_segment with unallocated segment: %s PE %uSkipping discard on missing device with uuid %s.Discarding %u extents offset %lu sectors on %s.release_pv_segment with unallocated segment: %s PE %uInternal error: _merge_free_pv_seg called on a segment that is not free.Internal error: WARNING: PV %s is without initialized PE ranges.PV segment pe_count mismatch: %u != %uPV segment pe_alloc_count mismatch: %u != %uPV segment VG pv_count mismatch: %u != %uPV segment VG free_count mismatch: %u != %uPV segment VG extent_count mismatch: %u != %uPhysical volume %s format does not support resizing.WARNING: %s: Overriding real size %s. You could lose data.%s: Requested size %s exceeds real size %s. Proceed? [y/n]: Physical Volume %s not resized.%s: Requested size %s is less than real size %s. Proceed? [y/n]: %s: Size is already %s (%lu sectors).WARNING: %s: Pretending size is %lu not %lu sectors.Resizing volume "%s" to %lu sectors.Size must exceed minimum of %lu sectors on PV %s.Size must exceed physical extent start of %lu sectors on PV %s.Format specific resize of PV %s failed.Size must leave space for at least one physical extent of %u sectors on PV %s.No change to size of physical volume %s.Resizing physical volume %s from %u to %u extents.%s: cannot resize to %u extents as there is only room for %lu.%s: cannot resize to %u extents as %u are allocated.%s: cannot resize to %u extents as later ones are allocated.Failed to store physical volume "%s"Failed to store physical volume "%s" in volume group "%s"Use pvcreate and vgcfgrestore to repair from archived metadata.metadata/pv_map.ccreate_pv_maps alloc failedpvl->pv->devto_go <= pva->countAllowing allocation on %s start PE %u length %uCouldn't create physical volume maps in %sconsume_pv_area_create_mapsmetadata/raid_manip.cFailed to allocate new name.rmetaMemory allocation failed.%s_%s_%%draid0_metaraid10_near (same as %s%s)recoverExtracting %u %s from %s.Failed to extract %s from %s.Shifting images in %s.Shifting %s and %s by %u.Failed to add sublv %s.LV %s in not partial.%s has enough space for %s.Failed to add %s to %s.%s_iorigFailed to get device count.Failed to get device health._extractedraid5_nFailed to resume %s.Post callout function failed._mlog__mimage__rmeta__rimage__rimage_0Adding %s to %s.Adjust data LVs of %s.Data LV renamed to %s.Can't convert %s LV %s to %s.Adding metadata LVs to %s.Can't convert %s to %s. losing %s resilienceRemoving mirror log %s.Failed to remove mirror log.Setting new segtype for %s.Renaming %s to %s.raid1 with reducingenhancingLogical volume %s NOT split. to %s typeRea--stripes-I/--stripesize-R/--regionsize? [y/n]: dm_snprintf failed.LV %s already has %u stripes.Too few stripes requested.Converting %s from %s to %s.Internal error: Missing image sub lv in area %u of LV %s.Internal error: bogus reshape space reallocation request [%d]Logical volume %s is already of requested type %s.Failed to new raid name for %s.New logical volume name "%s" is not valid.%sLogical Volume %s already exists in volume group %s.Extracting image components %s and %s from %s.Internal error: Unable to remove RAID layer from segment type %s.Internal error: Unable to remove RAID layer when there is more than one sub-lv.Activating logical volume %s before %s in kernel.Failed to activate %s before resuming %s.Internal error: stripes may not be 0.Can't convert %s LV %s with number of stripes not divisable by number of data copies.Internal error: LV %s is missing stripes.Failed to find a valid mirror in stripe %u!Internal error: Bad type provided to _alloc_raid_component.Component name for raid %s is too long.Failed to allocate new raid component, %s.Failed to add segment to LV, %s.No proper new segment length for %s!Region size may not be smaller than stripe size on %s LV %s.Region size is too large for %s LV %s.Cannot restripe LV %s from %u to %u stripes during conversion.Cannot determine sync percentage of %s.Unable to determine sync status of %s.WARNING: Sync status for %s is inconsistent.Can't remove reshape space from inactive LV %s.Can't get data offset for %s from kernel.Failed to allocate out-of-place reshape space for %s.Internal error: Bogus reshape space allocation request.%s not allowed when converting %s LV %s.%s not allowed for LV %s when converting from %s to %s.An entire mirror group has failed in %s.All components of raid LV %s have failed.More than %u components from %s %s have failed.%s contains a segment incapable of degraded activation.Unable to remove primary RAID image while array resyncing.Unable to remove RAID image while array is performing "%s"Internal error: RAID LV area_count differs from number of health charactersUnable to remove all primary source devicesUnable to remove %d images: Only %d device%s given.%s has components with error targets that must be removed first: %s.Try removing the PV list and rerun. the command.LVs with error segments to be removed: %s %sInternal error: Metadata segment area. #%d should be AREA_UNASSIGNED.Failed to shift and rename image components.Unable to extract enough images to satisfy request.Internal error: LVs must be set visible before removing.Failed to sync local devices after removing %u LVs in VG %s.Direct conversion of %s LV %s is not possible.Converting %s from %s%s is directly possible to the following layout%s:Logical volume %s already is type %s.Converting the segment type for %s from %s to %s is not supported.Converting the segment type for %s from %s to %s is not supported yet.Failed to prevent PVs holding image components from LV %s being used for allocation.Can't rebuild raid with integrity.Can't replace any devices in %s LV %s.%s must be active to perform this operation.Unable to replace devices in %s while it is not in-sync.Unable to repair %s/%s. Source devices failed before the RAID could synchronize.You should choose one of the following: 1) deactivate %s/%s, revive failed device, re-activate LV, and proceed. 2) remove the LV (all data is lost). 3) Seek expert advice to attempt to salvage any data from remaining devices.Unable to replace RAID images while the array has unassigned areas.Logical volume %s does not contain devices specified to %s.%s does not contain devices specified to %s.Unable to %s all PVs from %s at once.Unable to %s more than %u PVs from (%s) %s.Unable to %s all the devices in a RAID10 mirror group.Failed to prevent PVs holding image components from being used for allocation.Failed to replace %u devices. Attempting to replace %u instead.%u extents needed to repair %s.Not enough space on %s for %s.Failed to allocate replacement images for %s.Failed to remove the specified images from %s.Internal error: Bad type provided to %s.Extracting image component %s from %s.Extracting all MetaLVs of %s to activate as raid0.Deactivating pulled out MetaLVs of %s before initializing.Clearing allocated raid0_meta metadata LVs for conversion to raid4.Failed to initialize metadata LVs.Adding metadata LVs back into %s.LV %s has to be of type raid4 or raid5_n to allow for this conversion.Unable to convert %s while it is not in-sync.Are you sure you want to convert %s%s LV %s to %s%s type? [y/n]: Logical volume %s NOT converted to "%s".Converting LV %s from %s to %s.Failed to rename %s LV %s MetaLVs.Internal error: Pre callout function failed.Clearing any flags for %s passed to the kernel.Updating metadata mappings for %s.Adjusting region_size from %s to %s for %s.Adjusting region size of %s LV from %s to %s.Internal error: Cannot change region size of %s.Region size is already %s on %s LV %s.Region size is already matching %s on %s LV %s due to adjustment.Do you really want to change the region_size %s of LV %s to %s? [y/n]: Region size %s on %s is too small for metadata LV size.Unable to change region size on %s LV %s while it is not in-sync.Converting %s LV %s to regionsize %s.Changed region size on %s LV %s to %s.Failed to allocate string for new LV name.Internal error: Unable to allocate RAID metadata area for non-linear LV %s.Can't change number of mirrors of degraded %s.Please run "lvconvert --repair %s" first.WARNING: %s already has image count of %d.Failed to extract images from %s.Integrity must be removed before converting raid to linear.Are you sure you want to convert %s LV %s to type %s losing all resilience? [y/n]: Failed to remove RAID layer after linear conversion.Can't add image to out-of-sync RAID LV: use 'lvchange --resync' first.Can't add image to RAID LV that is still initializing.RAID module does not support rebuild+emptymeta.Unable to add RAID images to %s of segment type %s.Allocation of new areas failed.Allocation of new meta areas failed.Failed to clear REBUILD flag for %s components.Are you sure you want to convert %s back to the older %s type? [y/n]: Internal error: raid1 conversion supported only.can't convert %s to fewer than 2 data_copies.Unable to handle mirrors with more than %u devices.Unable to convert %s LV %s with %u images to %s.At least reduce to the maximum of %u images with "lvconvert -m%u %s".Changing image count to %u on %s.Extracting and renaming metadata LVs.Internal error: Name %s lags image part.Allocating metadata LVs for %s.Allocating new metadata LV for %s.Failed to allocate metadata LV for %s.Failed to allocate metadata LVs for %s.Clearing newly allocated metadata LVs for %s.Failed to initialize metadata LVs for %s.Adding newly allocated metadata LVs to %s.Failed to add newly allocated metadata LVs to %s.Internal error: No segment for %s.Failed to retrieve raid0 segments from %s.Cannot convert striped LV %s with varying stripe count to raid0.Cannot convert striped LV %s with non-power of 2 stripe size %u.Failed to allocate empty image components for raid0 LV %s.Failed to insert linear LVs underneath %s.Failed to allocate new raid0 segment for LV %s.N number of data_copies "--mirrors N-1" may not be larger than number of stripes.Minimum of %u stripes needed for conversion from %s to %s.Can't convert %s LV %s to %s with != 2 legs.Internal error: Bogus new_image_count converting %s LV %s to %s.Adding %u component LV pair(s) to %s.Extracting last image component pair of %s temporarily.Adding extracted last image component pair back to %s to convert to %s.Updating VG metadata and reloading %s LV %s.Reordering areas for raid0 -> raid10_near takeover.Can't convert %s LV %s to %s with odd number of stripes.Can't convert %s LV %s to %s with < 3 legs.Reordering areas for raid10 -> raid0 takeover.Removing %u component LV pair(s) to %s.Failed to allocate meta areas memory.Clearing newly allocated metadata LVs.Failed to allocate metadata LV for %s in %s.Are you sure you want to convert %s LV %s to %s%u images %s resilience? [y/n]: Splitting raid image is not allowed with lock_type %s.Integrity must be removed before splitting.Unable to split more than one image from %s.Unable to split logical volume of segment type, %s.%sLogical Volume "%s" already exists in %s.Unable to split %s while it is not in-sync.Are you sure you want to split %s LV %s losing all resilience? [y/n]: Losing all resilience for logical volume %s.Unable to split additional image from %s while tracking changes for %s.Failed to write changes for %s.Failed to suspend %s before committing changes.Failed to commit changes for %s.Failed to resume %s after committing changes.Unable to split images from non-mirrored RAID.Unable to split image from %s while not in-sync.Cannot track more than one split image at a time.Are you sure you want to split and track %s LV %s losing resilience for any newly written data? [y/n]: Losing resilience for newly written data on logical volume %s.%s split from %s for read-only purposes.WARNING: Any newly written data will be non-resilient on LV %s during the split!Use 'lvconvert --merge %s' to merge back into %s.Unable to find image to satisfy request.%s cannot be merged because --trackchanges was not used.Unable to merge non-raid image %s.Unable to find containing RAID array for %s.Failed to find meta for %s in RAID array %s.Failed to deactivate %s before merging.%s successfully merged back into %s.Internal error: New segtype not specified.Unable to handle raid arrays with more than %u devices.Checking LV %s requested %s segment type for convenienceConvert %s LV %s to 2 images first.Converting %s LV %s to 2 stripes first.Converting %s LV %s to %u stripes first.Convert %s LV %s to raid4/raid5 first.Convert %s LV %s to 2 stripes first (i.e. --stripes 1).Replaced LV type %s%s with possible type %s.Repeat this command to convert to %s after an interim conversion has finished.Unable to convert LV %s from %s to %s.WARNING: ignoring --stripes option on takeover of %s (reshape afterwards).WARNING: ignoring --stripesize option on takeover of %s (reshape afterwards).Are you sure you want to convert %s LV %sCan't convert RAID LV %s while under snapshot.RAID module does not support reshape.Region size may not be smaller than stripe size on LV %s.Can't remove stripes from raid10.Unable to convert stacked volume %s.Internal error: Failed to free reshape space of %s.No change in RAID LV %s layout, freeing reshape space.LV %s does not have reshape space allocated.Can't reshape out of sync LV %s.Device count is incorrect. Forgotten "lvconvert --stripes %d %s" to remove %u images after reshape?Internal error: Bad return=%d provided to %s.Converting stripesize %s of %s LV %s to %s.Ignoring layout change on device adding reshape.Can't reshape %s LV %s to odd number of stripes.WARNING: Adding stripes to active%s logical volume %s will grow it from %u to %u extents!Run "lvresize -l%u %s" to shrink it or use the additional capacity.Are you sure you want to add %u images to %s LV %s? [y/n]: Adding %u data and metadata image LV pair%s to %s.Failed to adjust LV %s to new size!Allocating reshape space for %s.(Re)allocating reshape space for %s.Setting delta disk flag on new data LVs of %s.Minimum 3 stripes required for %s LV %s.Ignoring layout change on device removing reshape.WARNING: Removing stripes from active%s logical volume %s will shrink it from %s to %s!THIS MAY DESTROY (PARTS OF) YOUR DATA!Interrupt the conversion and run "lvresize -y -l%u %s" to keep the current size if not done already!If that leaves the logical volume larger than %llu extents due to stripe rounding,you may want to grow the content afterwards (filesystem etc.)WARNING: to remove freed stripes after the conversion has finished, you have to run "lvconvert --stripes %u %s"Can't remove stripes without --force option.Are you sure you want to remove %u images from %s LV %s? [y/n]: No correct kernel/lvm active LV count on %s.No correct kernel/lvm total LV count on %s.Removing %u data and metadata image LV pair%s from %s.Internal error: Bad return provided to %s.WARNING: ignoring --stripesize on conversion of %s to 1 stripe.Converting %s%s LV %s to %s%s.Are you sure you want to convert %s LV %s? [y/n]: %sllocating reshape space for %s.Reshape request failed on LV %s.Invalid conversion request on %s.Can't convert %s LV %s to %s containing sub LVs to remove after a reshape.Run "lvconvert --stripes %u %s" first.Internal error: %s is not a partial LV.Attempting to remove missing devices from %s LV, %s.Replacing %s segments with error target.Failed to replace %s's extents with error target.Integrity must be removed before degraded or partial activation of raid._extract_image_component_error_seg_raid_reshape_remove_images_raid_reshapemetadata/segtype.cWARNING: Unrecognised segment type %sInternal error: Unrecognised segment type flag 0x%016lxmetadata/snapshot_manip.csnapshot%dlocked volumespvmoved volumeshidden volumescache type volumesthin pool type volumesmirror subvolumesraid subvolumesraid with integritySnapshot volume cannot be smaller than 3 chunks (%u extents, %s).Internal error: Cannot get origin from snapshot %s.'%s' is already in use as a snapshot.Snapshot and origin LVs must differ.Failed to find snapshot segtypeCouldn't allocate new snapshot segment.Failed to sync local devices before deactivating origin LV %s.Failed to deactivate logical volume "%s"Failed to remove internal snapshot LV %sPostponing write and commit for remove of snapshot %s.Failed to refresh %s without snapshot.an origin that has a merging snapshotWARNING: Snapshots of mirrors can deadlock under rare device failures.WARNING: Consider using the raid1 mirror type to avoid this.WARNING: See global/mirror_segtype_default in lvm.conf.Snapshots of %s are not supported.Internal error: data_lv_from_thin_pool arg not thin pool %sInternal error: LV %s already has external origin.Setting logical volume "%s" read-only.Internal error: Inconsitent external origin.Internal error: LV %s is not pool.Internal error: Cannot attach message to non-pool LV %s.Message referring LV %s already queued in pool %s.Delete for device %u already queued in pool %s.Failed to allocate memory for message.Internal error: pool_is_active called with non-pool volume %s.Pool's thin volume %s is active.Internal error: LV %s is not thin pool.WARNING: Thin pool %s%s%s%s%s%s.Threshold configured for free data space in thin pool %s has been reached (%s%% >= %s%%).WARNING: Remaining free space in metadata of thin pool %s is too low (%s%% >= %s%%). Resize is recommended.Threshold configured for free metadata space in thin pool %s has been reached (%s%% > %s%%).WARNING: Thin pool %s has unexpected transaction id %lu, expecting %lu%s. and the size of whole volume group and the amount of free space in volume groupWARNING: Sum of all thin volume sizes (%s) exceeds the size of thin pool%s%s%s (%s).WARNING: You have not turned on protection against thin pools running out of space.WARNING: Set activation/thin_pool_autoextend_threshold below 100 to trigger automatic extension of thin pools before they get full.WARNING: Set activation/thin_pool_autoextend_percent above 0 to specify by how much to extend thin pools reaching the threshold.Can't use "%s" as external origin with "%s" pool. Size %s is not a multiple of pool's chunk size %s.Internal error: Segment in %s is not a thin pool segment., perhaps skipped in lvm.conf volume_list?Internal error: Updated LV %s is not pool.Cannot activate thin pool %s%sPool %s needs to be locally active for threshold check.Free space in pool %s is above threshold, new volumes are not allowed.Failed to suspend %s with queued messages.Failed to sync local devices LV %s.Internal error: Cannot find configuration.Thin pool chunk size calculation policy "%s" is unrecognised.Using metadata size without cropping.Thin pool discards type "%s" is unknown.Internal error: Unknown discards type encountered.Cannot read thin pool %s transaction id locally, perhaps skipped in lvm.conf volume_list?Cannot use thin pool %s with transaction id %lu for thin volumes. Expected transaction id %lu.Deactivating public thin pool %s.Aborting. Could not deactivate thin pool %s.Thin pool chunk size %s is not in the range %s to %s.Thin pool chunk size %s must be a multiple of %s.Chunk size must be a power of 2 for this thin target version.Internal error: Could not find configuration.WARNING: Chunk size is too small for pool, suggested minimum is %s.WARNING: Chunk size is smaller then suggested minimum size %s.Selected chunk size %s cannot address more then %s of thin pool data space.Thin pool volume with chunk size %s can address at most %s of data.WARNING: Pool zeroing and %s large chunk size slows down thin provisioning.WARNING: Consider disabling zeroing (-Zn) or using smaller chunk size (<%s).metadata/thin_manip.cAdded %s message. has read-only metadata is erroring needs check is out of data space is failed or lower by 1no free space in volume groupLV %s has no segment.Cannot find free device_id.Found free pool device_id %u.performanceCropping metadata size to %s.Setting chunk size %s.Enabling%s pool zeroing on default.Failed to build device path for VDO formating of data volume %s.Slab size %s converted to %u bits.Internal error: Unable to find configuration for vdoformat command options.Invalid string in config file: global/vdoformat_options.Internal error: Failed to wipe logical VDO data for volume %s.WARNING: Cannot read output from %s.Logical blocks defaulted to %lu blocksAvailable VDO logical blocks %lu (%s).Number of VDO logical blocks was not provided by vdo_format output.Internal error: Unrecognized compression state: %u.Internal error: Unrecognized index state: %u.Internal error: Unrecognized operating mode: %u.Internal error: Unrecognized VDO write policy: %u.Failed to build VDO DM name %s.Cannot parse %s VDO pool status %s.statistics/logical_blocks_usedRounding size up to 4,00 KiB VDO logical extent boundary: %s.Test mode: Skipping formating of VDO pool volume.Cannot format VDO pool volume %s.Cannot deactivate formated VDO pool volume %s.Cannot create fully fitting VDO volume, --virtualsize has to be specified.Size %s for VDO volume cannot be smaller then extent size %s.metadata/vdo_manip.c--logical-size=%luK--slab-bits=%u--uds-checkpoint-frequency=%u--uds-memory-size=%u--uds-memory-size=0.%u--uds-sparseCommand %s failed.%s/block/dm-%d/vdo/%sFailed to build kvdo path.%skvdo/%s/%sstrtoolofflineclosedopeningclosingrecoveringnormalasyncasync-unsafestatistics/data_blocks_usedSkiping VDO formating %s._vdataUnknown VDO write policy %s. ,Freeing VG %s at %p.Failed to allocate VG name.Allocated VG %s at %p. free space allocated space PV segment start PV segment length area length extents moved virtual extents pvseg start pvseg length area startMaxLogicalVolume limit is 255vg_set_lock_type %s no memInternal error: VG is NULL.No device found for PV.vgreduce_single VG %s PV %sMirrored transient status: "%s"Active mirror has a wrong number of mirror images!Metadata says %u, kernel says %u.Check for existence of mirror log %s failed.Mirror log mismatch. Metadata says %d:%d, kernel says %u:%u.Check for existence of mirror image %s failed.Failed to find image %d (%d:%d).Couldn't read 'extents_moved' for segment %s of logical volume %s.Couldn't read 'region_size' for segment %s of logical volume %s.Unrecognised mirror log in segment %s of logical volume %s.Missing region size for mirror log for segment %s of logical volume %s.Couldn't find mirrors array for segment %s of logical volume %s.mirror string list allocation failedstruct mirr_state allocation failedMissing region size for mirror segment.Failed to build uuid for log LV %s.Failed to build uuid for mirror LV %s.WARNING: Mirror %s without monitoring will not react on failures.Couldn't read 'mirror_count' for segment '%s'.mirror/mirrored.cFound mirror log at %d:%dStatus of log (%d:%d): %c.Found mirror image at %d:%dStatus of image %d: %c.extents_movedmirror_count = %uextents_moved = %umirror_log = "%s"region_size = %u Mirrors %u Mirror size %u Mirror log volume %s Mirror region size %s Mirror original: Mirror destinations:mirror_count0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-misc/lvm-exec.cExecuting:%sforkexecvpChild %u exited abnormally%s failed: %upipePiping:%s/dev/nullpipe[0]STDOUTpipe[1]STDINwaitpidInternal error: Missing command.Failed to sync local device names before forking.wait4 child process %u failed: %smisc/lvm-file.cgethostname%s/.lvm_%s_%d_%d%s: rename to %s failedsync_dir failed in strdupF_WRLCKF_RDLCKLocking %s (%s, %hd)fcntlUnlocking fd %d%s: write errorNot enough space to build temporary file string.fcntl_lock_file failed in strdup._undo_flock %smisc/lvm-flock.cUnlocking %sflock_drop_shared_flock %s._do_flock %s %c%cGiving up waiting for lock.Unrecognised lock type: %dLocking %s %c%c convertLocking %s %c%cFailed to convert flock on %s %dTEST MODE: Metadata will NOT be updated and volumes will not be (de)activated.LVM activation checks disabledmisc/lvm-globals.c%s[%d]LVM udev checking enabledLVM udev checking disabledLVM activation checks enabled[unknown]misc/lvm-signal.csigprocmasksigactionSIG_SETMASKInterrupted..._block_signalssigfillsetSIGINTSIGTERMNames starting "%s" are reserved. Please choose a different LV name.Names including "%s" are reserved. Please choose a different LV name.Failed to build LVM dlid for %s.Internal error: Name is too long.misc/lvm-string.c_cdata_cmeta_corig_cpool_cvol_wcorig_mimage_mlog_rimage_rmeta_tdata_tmeta_vdata_imeta_iorig_pmspare_voriginpvmovesnapshotUdev library context not set.misc/lvm-wrappers.cCould not get udev state.Assuming udev is not running.read_urandom: /dev/urandom/run/cmirrord.pidFailed to create udev library context.WARNING: Failed to reserve memory, %d bytes missing.Allocation of maps buffer failed.%s area unreadable %s : Skipping.%s ignore filter '%s' matches '%s': Skipping.%s default filter '%s' matches '%s': Skipping.%s_filter '%s' matches '%s': Skipping.%s %10ldKiB %12lx - %12lx %c%c%c%c%sLock: Memlock counters: prioritized:%d locked:%d critical:%d daemon:%d suspended:%dRaised task priority %d -> %d.WARNING: setpriority %d failed: %s.Restoring original task priority %d.WARNING: setpriority %u failed: %s.Unlock: Memlock counters: prioritized:%d locked:%d critical:%d daemon:%d suspended:%dInternal error: Reserved memory (%ld) not enough: used %ld. Increase activation/reserved_memory?Suppressed internal error: Maps lock %ld < unlock %ld, a one-page difference.Entering critical section (%s).Entering prioritized section (%s).Leaving critical section (%s).Internal error: _memlock_inc_daemon used in critical section.memlock_count_daemon inc to %dInternal error: _memlock_count_daemon has dropped below 0.memlock_count_daemon dec to %dmm/memlock.c[vectors][vdso][vsyscall]locale/locale-archiveUnlmunlockalllseekmunlock%lx-%lx %c%c%c%c%nFailed to parse maps line: %s%socked %ld bytesLocking memory%s/self/mapsproc_dir too longgetpriorityUnlocking memoryLeaving section (%s).memlock reset./LC_MESSAGES/gconv/gconv-modules.cache/ld-2./libaio.so./libattr.so./libblkid.so./libbz2.so./libcap.so./libdl-/libdw-/libelf-/libgcrypt.so./libgpg-error.so./liblz4.so./liblzma.so./libmount.so./libncurses.so./libpcre.so./libpcre2-/libreadline.so./libedit.so./libresolv-/libselinux.so./libsepol.so./libsystemd.so./libtinfo.so./libudev.so./libuuid.so./libz.so./etc/selinuxFailed to connect to dbus: %dnotify/lvmnotify.ccom.redhat.lvmdbus1Nofify dbus at %s.ExternalEventcom.redhat.lvmdbus1.Manager/com/redhat/lvmdbus1/ManagerWARNING: %s: %sorg.freedesktop.systemd1.NoSuchUnitorg.freedesktop.DBus.Error.ServiceUnknownFailed to parse dbus response message: %dBad return value from dbus service: %dD-Bus notification failedFunction not implementedproperties/prop_common.cInvalid property name %sProperty name %s does not match type %dUnable to set read-only property %sshrinkingrebuild+emptymetareshapingraid/raid.cRaid transient status %s.raid0_lvsstripe_sizeNo areas found for segment %sraid0_lvstripe_count = %ustripe_size = %udevice_count = %uwritebehind = %umin_recovery_rate = %umax_recovery_rate = %udata_offset = %u Raid Data LV%2d Raid Metadata LV%2d %sdevice_countstripe_countTarget raid does not support %s.Active raid has a wrong number of raid images!Check for existence of raid meta %s failed.Check for existence of raid image %s failed.RAID target does not support RAID4 for LV %s.Internal error: _raid_add_target_line called with no areas for %s.Unable to handle more than %u devices in a single RAID arrayMissing region size for raid segment in %s.Internal error: Invalid request for delta disks minus and delta disks plus!Couldn't read '%s' for segment %s of logical volume %s.Couldn't find RAID array for segment %s of logical volume %s.Missing data device in areas array for segment %s.Failed to import RAID component pairs.raid module string list allocation failedCouldn't read 'device_count' or 'stripe_count' for segment '%s'.Only one of 'device_count' and 'stripe_count' allowed for segment '%s'.Failed to allocate memory for %s segtyperaid0raid0_metaraid1raid10 raid10_near raid4@raid5raid5_nraid5_laraid5_lsraid5_raraid5_rsraid6@raid6_n_6raid6_ncraid6_nr raid6_zr@raid6_ls_6raid6_rs_6raid6_la_6raid6_ra_6report/properties.clv_full_namelv_pathlv_dm_pathlv_parentlv_layoutlv_rolelv_initial_image_synclv_image_syncedlv_merginglv_convertinglv_allocation_policylv_allocation_lockedlv_fixed_minorlv_skip_activationlv_autoactivationlv_when_fulllv_activelv_active_locallylv_active_remotelylv_active_exclusivelylv_majorlv_minorlv_read_aheadlv_sizelv_metadata_sizeseg_countorigin_uuidorigin_sizelv_ancestorslv_full_ancestorslv_descendantslv_full_descendantsraid_mismatch_countraid_sync_actionraid_write_behindraid_min_recovery_rateraid_max_recovery_rateintegritymismatchesmove_pvmove_pv_uuidconvert_lvconvert_lv_uuidmirror_log_uuidmetadata_lvmetadata_lv_uuidpool_lvpool_lv_uuidlv_tagslv_profilelv_lockargslv_timelv_time_removedlv_hostlv_moduleslv_historicallv_kernel_majorlv_kernel_minorlv_kernel_read_aheadlv_permissionslv_suspendedlv_live_tablelv_inactive_tablelv_device_opensnap_percentmetadata_percentcopy_percentsync_percentcache_used_blockscache_dirty_blockscache_read_hitscache_read_missescache_write_hitscache_write_misseskernel_cache_settingskernel_cache_policykernel_metadata_formatlv_health_statuskernel_discardslv_check_neededlv_merge_failedlv_snapshot_invalidvdo_operating_modevdo_compression_statevdo_index_statevdo_used_sizevdo_saving_percentwritecache_total_blockswritecache_free_blockswritecache_writeback_blockswritecache_errorlv_attrpv_fmtpv_majorpv_minorpv_mda_freepv_mda_sizepv_ext_vsnpv_sizepv_freepv_usedpv_attrpv_allocatablepv_exportedpv_missingpv_pe_countpv_pe_alloc_countpv_tagspv_mda_countpv_mda_used_countpv_ba_startpv_ba_sizepv_in_usepv_duplicatepv_device_idpv_device_id_typevg_fmtvg_uuidvg_attrvg_permissionsvg_extendablevg_exportedvg_autoactivationvg_partialvg_allocation_policyvg_clusteredvg_sharedvg_sizevg_freevg_sysidvg_systemidvg_lock_typevg_lock_argsvg_extent_sizevg_extent_countvg_free_countvg_missing_pv_countlv_countsnap_countvg_seqnovg_tagsvg_profilevg_mda_countvg_mda_used_countvg_mda_freevg_mda_sizevg_mda_copiesdata_stripesreshape_lenreshape_len_lenew_data_offsetparity_chunksthin_countthin_idseg_start_peseg_size_peseg_tagsseg_pe_rangesseg_le_rangesseg_metadata_le_rangesmetadata_devicesseg_monitorvdo_compressionvdo_deduplicationvdo_block_map_cache_sizevdo_block_map_era_lengthvdo_index_memory_sizevdo_slab_sizevdo_header_sizepvseg_sizereport/report.cdm_pool_strdup failedrefresh neededmismatches existout_of_datalvname snprintf failedagotime_now@%ld:@%ldskip activationqueue_dup_Failed to get segtype name.Failed to allocate buffer.lvm2_Log sequence number.Log type.Current context.Current object type.Current object name.Current object ID.Current object group.Current object group ID.Log message.Errno.Return code.Description of Device Type.Unique identifier.LV layout.LV role.Set if LV is being converted.LV allocation policy.Active state of the LV.Size of LV in current units.Number of segments in LV.The integrity modeThe integrity block sizeTags, if any.Set if the LV is historical.The writecache block sizeLV permissions.Set if LV is suspended.Set if LV device is open.Total cache blocks.Used cache blocks.Dirty cache blocks.Cache read hits.Cache read misses.Cache write hits.Cache write misses.Cache policy used in kernel.LV health status.Set if snapshot merge failed.Total writecache blocks.Total writecache free blocks.Total writecache errors.Type of metadata.Name.Device major number.Device minor number.PV header extension version.Size of PV in current units.Set if PV is used.Device ID such as the WWID.VG permissions.Set if VG is extendable.Set if VG is exported.Set if VG is partial.VG allocation policy.Set if VG is clustered.Set if VG is shared.Number of PVs in VG.Number of LVs.Number of snapshots.Type of LV segment.Number of data copies.Sparse indexing (vdopool).IO enqueue (vdopool).Number of extents in segment.Device Typesdevtype_vg_Logical Volumelv_Logical Volume Device InfoLogical Volume Device StatusPhysical Volumepv_Physical Volume LabelLogical Volume SegmentPhysical Volume Segmentpvseg_Command Logqueue when fullqueue if no spaceerror when fullerror if no spaceread-only-overridero-overrider-overridewriteableread-writecheck neededinactive table presentinactive tableinactivelive table presentlive tablelivesnapshot invalidmerge failedactive exclusivelyactive remotelyactive locallyfixed minorfixedallocation lockedimage syncedinitial image syncunmanagedundeftodayyesterdaySundaySunMondayMonTuesdayTueWednesdayWedThursdayThuFridayFriSaturdaySatnoonmidnightsecondsecminutehourhrAMPMweekmonthyearyrJanuaryJanFebruaryFebMarchMarAprilAprMayJuneJunJulyJulAugustAugSeptemberSepOctoberOctNovemberNovDecemberDecFailed to allocate buffer for mode.alloc_time_item: dm_pool_zalloc failed_get_glv_str: dm_snprintf failed_get_now: dm_pool_zalloc failed_get_now: failed to cache current time_preparse_fuzzy_time: dm_pool_alloc failedUnrecognized string in date/time specification at "%s".Unrecognized number in date/time specification at "%s".Mixed absolute and relative date specification found at "%s".Ambiguous date specification found at "%s".Mixed absolute and relative time specification found at "%s".Ambiguous time specification found at "%s"._translate_time_items: invalid time._translate_time_items: dm_snprintf failed_translate_time_items: dm_pool_strdup failedFailed to get value for parsed time specification.Failed to allocate space to store time range.Failed to allocate buffer for host.Failed to allocate buffer for time.Failed to allocate buffer for active.Failed to display role for LV %s/%s.Failed to display layout for LV %s/%s.Name of Device Type exactly as it appears in /proc/devices.Maximum number of partitions. (How many device minor numbers get reserved for each device.)Name. LVs created for internal use are enclosed in brackets.Full name of LV including its VG, namely VG/LV.Full pathname for LV. Blank for internal LVs.Internal device-mapper pathname for LV (in /dev/mapper directory).For LVs that are components of another LV, the parent LV.Set if mirror/RAID images underwent initial resynchronization.Set if mirror/RAID image is synchronized.Set if snapshot LV is being merged to origin.Set if LV is locked against allocation changes.Set if LV has fixed minor number assigned.Set if LV is skipped on activation.Set if LV autoactivation is enabled.For thin pools, behavior when full.Set if the LV is active locally.Set if the LV is active remotely.Set if the LV is active exclusively.Persistent major number or -1 if not persistent.Persistent minor number or -1 if not persistent.Read ahead setting in current units.For thin and cache pools, the size of the LV that holds the metadata.For snapshots and thins, the origin device of this LV.For snapshots and thins, the UUID of origin device of this LV.For snapshots, the size of the origin device of this LV.LV ancestors ignoring any stored history of the ancestry chain.LV ancestors including stored history of the ancestry chain.LV descendants ignoring any stored history of the ancestry chain.LV descendants including stored history of the ancestry chain.For RAID, number of mismatches found or repaired.For RAID, the current synchronization action being performed.For RAID1, the number of outstanding writes allowed to writemostly devices.For RAID1, the minimum recovery I/O load in kiB/sec/disk.For RAID1, the maximum recovery I/O load in kiB/sec/disk.The number of integrity mismatches.For pvmove, Source PV of temporary LV created by pvmove.For pvmove, the UUID of Source PV of temporary LV created by pvmove.For lvconvert, Name of temporary LV created by lvconvert.For lvconvert, UUID of temporary LV created by lvconvert.For mirrors, the LV holding the synchronisation log.For mirrors, the UUID of the LV holding the synchronisation log.For cache/thin/vdo pools, the LV holding the associated data.For cache/thin/vdo pools, the UUID of the LV holding the associated data.For cache/thin pools, the LV holding the associated metadata.For cache/thin pools, the UUID of the LV holding the associated metadata.For cache/thin/vdo volumes, the cache/thin/vdo pool LV for this volume.For cache/thin/vdo volumes, the UUID of the cache/thin/vdo pool LV for this volume.Configuration profile attached to this LV.Lock args of the LV used by lvmlockd.Creation time of the LV, if knownRemoval time of the LV, if knownCreation host of the LV, if known.Kernel device-mapper modules required for this LV.Currently assigned major number or -1 if LV is not active.Currently assigned minor number or -1 if LV is not active.Currently-in-use read ahead setting in current units.Set if LV has live table present.Set if LV has inactive table present.For snapshot, cache and thin pools and volumes, the percentage full if LV is active.For snapshots, the percentage full if LV is active.For cache and thin pools, the percentage of metadata full if LV is active.For Cache, RAID, mirrors and pvmove, current percentage in-sync.Cache settings/parameters as set in kernel, including default values (cached segments only).Cache metadata format used in kernel.For thin pools, how discards are handled in kernel.For thin pools and cache volumes, whether metadata check is needed.Set if snapshot LV is invalid.For vdo pools, its current operating mode.For vdo pools, whether compression is running.For vdo pools, state of index for deduplication.For vdo pools, currently used space.For vdo pools, percentage of saved space.Total writecache writeback blocks.Various attributes - see man page.Size of underlying device in current units.Free metadata area space on this device in current units.Size of smallest metadata area on this device in current units.Offset to the start of data on the underlying device.Total amount of unallocated space in current units.Total amount of allocated space in current units.Set if this device can be used for allocation.Set if this device is exported.Set if this device is missing in system.Total number of Physical Extents.Total number of allocated Physical Extents.Number of metadata areas on this device.Number of metadata areas in use on this device.Offset to the start of PV Bootloader Area on the underlying device in current units.Size of PV Bootloader Area in current units.Set if PV is an unchosen duplicate.Type of device ID such as WWID.Set if VG autoactivation is enabled.Total size of VG in current units.Total amount of free space in current units.System ID of the VG indicating which host owns it.Lock type of the VG used by lvmlockd.Lock args of the VG used by lvmlockd.Size of Physical Extents in current units.Total number of unallocated Physical Extents.Maximum number of LVs allowed in VG or 0 if unlimited.Maximum number of PVs allowed in VG or 0 if unlimited.Number of PVs in VG which are missing.Revision number of internal metadata. Incremented whenever it changes.Configuration profile attached to this VG.Number of metadata areas on this VG.Number of metadata areas in use on this VG.Free metadata area space for this VG in current units.Size of smallest metadata area for this VG in current units.Target number of in use metadata areas in the VG.Number of stripes or mirror/raid1 legs.Number of data stripes or mirror/raid1 legs.Size of out-of-place reshape space in current units.Size of out-of-place reshape space in logical extents.Data offset on each image device.New data offset after any reshape on each image device.Number of (rotating) parity chunks.For stripes, amount of data placed on one device before switching to the next.For mirrors/raids, the unit of data per leg when synchronizing devices.For snapshots, the unit of data used when tracking changes.For thin pools, the number of thin volumes in this pool.For thin pools, how discards are handled.For cache, metadata format in use.For cache, how writes are cached.For thin pools and volumes, if zeroing is enabled.For thin pools, the transaction id and creation transaction id for thins.For thin volume, the thin device id.Offset within the LV to the start of the segment in current units.Offset within the LV to the start of the segment in physical extents.Size of segment in current units.Size of segment in physical extents.Ranges of Physical Extents of underlying devices in command line format (deprecated, use seg_le_ranges for common format).Ranges of Logical Extents of underlying devices in command line format.Ranges of Logical Extents of underlying metadata devices in command line format.Underlying devices used with starting extent numbers.Underlying metadata devices used with starting extent numbers.Dmeventd monitoring status of the segment.The cache policy (cached segments only).Cache settings/parameters (cached segments only).Set for compressed LV (vdopool).Set for deduplicated LV (vdopool).Use REQ_SYNC for writes (vdopool).Minimum acceptable IO size (vdopool).Allocated caching size (vdopool).Speed of cache writes (vdopool).Allocated indexing memory (vdopool).Increment size for growing (vdopool).Acknowledging threads (vdopool).IO submitting threads (vdopool).CPU threads for compression and hashing (vdopool).Threads for subdivide parts (vdopool).Logical threads for subdivide parts (vdopool).Physical threads for subdivide parts (vdopool).Maximum discard size volume can recieve (vdopool).Specified write policy (vdopool).Header size at front of vdopool.Physical Extent number of start of segment.Logical Volume Device Info and Status CombinedReserved value for undefined numeric value.DW= 3.6).Failed to build uuid for metadata LV %s.WARNING: Thin pool target does not support discards (needs kernel >= 3.4).WARNING: Thin pool target does not support error if no space (needs version >= 1.10).Internal error: Unsupported message.Thin pool set transaction id %lu.Metadata must be a string in segment %s of logical volume %s.Unknown metadata %s in segment %s of logical volume %s.Pool must be a string in segment %s of logical volume %s.Unknown pool %s in segment %s of logical volume %s.Could not read chunk_size segment %s of logical volume %s.Could not read discards for segment %s of logical volume %s.Discards option unsupported for segment %s of logical volume %s.Unsupported value %u for chunk_size segment %s of logical volume %s.Could not read zero_new_blocks for segment %s of logical volume %s.Could not read crop_metadata for segment %s of logical volume %s.Unknown LV %s for create message in segment %s of logical volume %s.Unknown message in segment %s of logical volume %s.Internal error: Invalid discards value %d.Internal error: Invalid zero new blocks value %d.Internal error: LV %s is not a thin volume.Internal error: Passed unsupported message.global/thin_disabled_featuresthinthin-poolUUID contains invalid character '%c'Couldn't write uuid, buffer too small.Too many characters to be uuid.Couldn't read uuid: incorrect number of characters.uuid/uuid.c0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ!#zero/zero.czero module string list allocation failedactivate/dev_manager.cLV percent: %s-cmetaRunning check command on %s-VbetteroldercryptostratisCRYPT-TEMPCRYPT-SUBDEVstratis-blocked_mirrors block_on_error%d:%d %d:%d%s: %s device %s not usable.invalid snapshotsfrozen raidfrozenunusable_thinsRemoving dm dev %u:%uPrelAdding new LV %s%s%s to dtree%*u:%*u %u%sblock/dm-%u/holdersFound holder %s of %s. origin-onlyCreating %s%s tree for %s.Deleting tracked UUID %s.dev_managerChecking device id for LV %s.missing_%d_%dFailed to set query_inactive_table.WARNING: Failed to disable open_count.WARNING: Failed to set no_flush.WARNING: Cannot find matching %s segment for %s.Internal error: WARNING: Segment type %s found does not match expected type %s for %s.Number of segments in active LV %s does not match metadata.Kernel driver has incomplete udev support so LVM will check and perform some operations itself.Failed to allocated path for callback.Internal error: Registering unsupported pool callback.Failed to build device path for checking cachevol metadata %s.Failed to build device path for checking pool metadata %s.Metadata checking skipped, detected empty disk header on %s.Internal error: Unable to find configuration for pool check options.Invalid string in config file: global/%s_check_options.Too many options for %s command.WARNING: Check is skipped, please install recommended missing binary %s!Found version of %s %s is %s then requested %u.%u.%u.WARNING: Cannot parse output '%s' from %s.WARNING: Check is skipped, please upgrade installed version of %s!Check of pool %s failed (status:%d). Manual repair required!WARNING: Integrity check of metadata for pool %s failed.Skipping checks for old devices without LVM- dm uuid prefix (kernel vsn %d >= %d).Getting device info for %s [%s].Failed to add device (%u:%u) to dtree.Tracking pending delete for %s %s (%s).Internal error: _emit_target cannot handle segment type %s.WARNING: Cannot get info from tree node for %s.%s: Empty device %s not usable.%s: Suspended device %s not usable.%s: Reserved uuid %s on internal LV device %s not usable.%s: Reserved internal LV device %s/%s%s%s not usable.%s: Reserved uuid %s on %s device %s not usable.%s: Scanning mirror devices is disabled.%s: Mirror image %d marked as failed.%s: Mirror log device marked as failed.%s: Mirror device %s not usable.WARNING: Incorrect snapshot table found for %d:%d.WARNING: Incorrect snapshot-origin table found for %d:%d.%s: Invalid %s device %s not usable.WARNING: %s frozen raid device (%d:%d) needs inspection.%s: Frozen %s device %s not usable.WARNING: Cannot get thin-pool major:minor for thin device %d:%d.WARNING: %s: Thin's thin-pool needs inspection.%s: Error device %s not usable.%s: I/O blocked to mirror device.Failed to set device number for remove %u:%uWARNING: Using linear target for %s/%s: Striped requires extent size (%u sectors) >= page size (%u)._add_new_lv_to_dtree: pool alloc failed for %s %s.Add cachevol %s to dtree before cache %s.Failed to add cachevol to dtree before cache.Using error for pending meta delete %s.Using error for pending data delete %s.%soaded thin volume %s with id %u is %smatching id %u.Merging of snapshot volume %s to origin %s is in progress.Postponing pending snapshot merge for origin %s, merge was not started before suspend.Postponing pending snapshot merge for origin %s, origin volume is opened.Postponing pending snapshot merge for origin volume %s, merging thin snapshot volume %s is active.Postponing pending snapshot merge for origin volume %s, merging snapshot volume %s is opened.Internal error: LV %s is not merging snapshot.Couldn't find snapshot for '%s'.Checking kernel supports %s segment type for %s%s%sCan't process LV %s: %s target support missing from kernel?Adding external origin LV %s and all active users.Finished adding external origin LV %s and all active users.Using error for pending delete %s.sysfs_path dm_snprintf failed.Failed to parse dm device minor number from %s.Checking holder of %s %s (%u:%u) %s.Cannot find holder with device name %s in VG %s.Volume %s (%u:%u) differs from already active device (%u:%u).The requested major:minor pair (%u:%u) is already used.Tracking pending delete for %s (%s).Internal error: Cannot create tree for %s.Partial dtree creation failed for %s.Lost dependency tree root node._clean_tree: Couldn't split up device name %s._clean_tree: Failed to duplicate uuid.Failed to remove all device symlinks associated with %s._create_lv_symlinks: Couldn't split up old device name %s._create_lv_symlinks: Couldn't split up new device name %s.Failed to create symlinks for %s.Getting device %s status percentage for %s.Checking raid status for volume %s.Expected %s segment type but got %s instead.Internal error: %s is not a RAID logical volume.Internal error: Unknown RAID message: %s.Internal error: %s is not a writecache logical volume.Checking status for cache volume %s.Checking thin pool status for LV %s.Checking thin status for LV %s.More then one table line found for %s.Unexpected target type %s found for thin %s.Cannot parse table like parameters %s for %s.Checking VDO pool status for LV %s.Aborting. LV %s is now incomplete and '--activationmode partial' was not specified.Internal error: Unassigned area found in LV %s.Cannot activate %s: pool incomplete.Internal error: _add_error_or_zero_device called with bad segment.Failed to create partial dtree.Failed to add device %s (%u:%u) to dtree.PRELOADACTIVATEDEACTIVATESUSPENDSUSPEND_WITH_LOCKFSCLEANactivate/fs.cRemoving link %s%s/groupCouldn't create path for %s.Removing %sLinking %s -> %ssymlinkCreating directory %smkdirRemoving directory %sSyncing device namesCouldn't determine link pathname.The link %s should have been removed by udev but it is still present. Falling back to direct link removal.%s not symbolic link - not removingCouldn't create destination pathname for logical volume link for %sCouldn't create pathname for LVM1 group file for %sNon-LVM1 character device found at %sSymbolic link %s not created: file existsSymlink %s that should have been created by udev does not have correct target. Falling back to direct link creationSymlink %s that should have been created by udev could not be checked for its correctness. Falling back to direct link creation.The link %s should have been created by udev but it was not found. Falling back to direct link creation.Couldn't create path for volume group dir %sCouldn't create source pathname for logical volume link %sCouldn't construct name of volume group directory.No space to stack fs operationreasonlvmpolld/lvmpolld-client.clvname = %svgname = %slvid = %scmdline = %sinterval = %sFailed to create %s request.abort = %ldhandle_missing_pvs = %ldsysdir = %sdevicesfile = %sOK abortprogress_infoin_progresssignalnot_foundlvmpolld failed to process a request. The reason was: %s.lvmpolld couldn't handle a request. It might be due to daemon internal state. The reason was: %s.Unexpected response %s. The reason: %s.For more information see lvmpolld messages in syslog or lvmpolld log file.Interval string conversion got truncated.Failed to process request with error %s (errno: %d).Sucessfully connected to lvmpolld on fd %d.WARNING: Failed to connect to lvmpolld. Proceeding with polling without using lvmpolld.WARNING: Check global/use_lvmpolld in lvm.conf or the lvmpolld daemon state.Internal error: Use of lvmpolld requires uuid setInternal error: Use of lvmpolld requires vgname setInternal error: Use of lvmpolld requires lvname setAsking lvmpolld for pvmove%s on %s/%s.Asking lvmpolld for mirror conversion on %s/%s.Asking lvmpolld for snapshot merge on %s/%s.Asking lvmpolld for thin snapshot merge on %s/%s.Internal error: Unsupported poll operation.Internal error: Unsupported poll operationInternal error: use of lvmpolld requires uuid being setAsking lvmpolld for progress status of an operation on %s/%s.Failed to create progress_info request.No polling operation in progress regarding LV %s.Command executed by lvmpolld got terminated by signal (%d).LVM command run by lvmpolld responded with: 'No such command.'LVM command run by lvmpolld failed due to invalid parameters.LVM command executed by lvmpolld failed.lvmpolld failed to duplicate file descriptors.lvmpolld failed to exec() lvm binary.lvmpolld responded with unexpected return code.Polling finished successfully.path_num = %ldFailed to create pvs request.locking/lvmlockd.cpath[%d] = %%sFailed to refresh %s.lockd_result reply error %dlockd_result bad responselockd_result no op_resultresult_flagsNO_LOCKSPACESNO_GL_LSNO_LMDUP_GL_LSWARN_GL_REMOVEDSH_EXISTSvg_name = %spid = %ldbusy_vgvg_lock_args = %svg_lock_type = %sfree_vginit_vgVG %s init failed: %dsanlock lvmlock LV removedFail to any PVs for VG %sVG %s find PV device %scmd = %slv_lock_args = %slv_uuid = %slv_name = %sopts = %smode = %slvmlockd %s %s result %d %x/run/lvmlockd.pid/run/lvm/lvmlockd.socketfind_free_lockUnknown sector size %u.Failed to create internal lv.Unknown lock_type.start_initstart_vghost_id = %ldversion = %ldvg_uuid = %sVG %s starting %s lockspaceVG %s start failed: %dlockd stop VG %s lock_type %sstop_vgVG %s stop failed: %dstart_waitLock start failedlockd global lock_type %sUnknown lock-gl modelock_glRetrying %s global lockEnabling sanlock global lockGlobal lock failed: error %dlockd global mode %sGlobal lock failed: error %d.lockd VG %s mode %slock_vgRetrying %s lock on VG %sVG %s lock failed: removedVG %s lock skipped: error %dVG %s lock failed: error %dvg_updatelvextendlvresizelvchangelockd query LV %s/%squery_lock_lvLocking failed for LV %s/%sRefresh lvmlockNo vdo pool for %s/%sshupdatenorefresh/etc/mtabgfs2ocfs2%s/%s/%sinit_lvlv_lock_argslv_lock_args not returnedFailed to find vdo pool %s/%sFailed to lock vdo pool %s/%sfree_lv_free_lv lvmlockd result %drename_vg_finalrunning_lmlvmlockd found sanlocklvmlockd found dlmlvmlockd found idmFailed to unlock LV %s/%s.rename_vg_beforerefresh_lvpath = %sLV refresh failed for LV %sExtend sanlock LV from %llus (%llu bytes) to %us (%u bytes)Extend sanlock LV %s to size %s failed.Failed to refresh sanlock LV %s after extend.Extend sanlock LV %s name too long - extended size not zeroed.Extend sanlock LV zeroing %u bytes from offset %llu to %lluZeroing %u MiB on extended internal lvmlock LV...Extend sanlock LV %s cannot find device.Extend sanlock LV %s cannot open device.Extend sanlock LV %s cannot zero device at %lu.lockd_result %d flags %s lm %sLockspace for "%s" not stopped on other hosts%s: lock type %s lvmlockd result %dVG %s init failed: lvmlockd not availableVG %s init failed: invalid parameters for dlmVG %s init failed: lock manager %s is not runningVG %s init failed: lock manager %s is not supported by lvmlockdVG %s init failed: a lockspace with the same name existsVG %s init failed: lock_args not returnedVG %s init failed: lock_args alloc failedVG %s init failed: vg_write vg_commitFailed to deactivate sanlock lv %s/%sFailed to remove sanlock LV %s/%sFailed to activate sanlock lv %s/%sFail to allocate PV list for VG %sFail to allocate PV path for VG %slvmlockd %s %s vg %s lv %s result %d %xlvmlockd %s %s vg %s result %d %xlvmlockd %s %s failed no resultCreating lvmlock LV for sanlock with size %um %ub %u extentsFailed to create sanlock lv %s in vg %sShould not initialize lvmlockd with use_lvmlockd=0.WARNING: lvmlockd socket location is not configured.WARNING: lvmlockd process is not running.Should not connect to lvmlockd with use_lvmlockd=0.lvmlockd is already connected.Successfully connected to lvmlockd on fd %d.WARNING: lvmlockd connect failed.Using sector size %u for sanlock LVVG %s init failed: invalid parameters for sanlockVG %s init failed: sanlock cannot open device /dev/mapper/%s-%sCheck that sanlock has permission to access disks.VG %s init failed: lock manager sanlock is not runningVG %s init failed: lock manager sanlock is not supported by lvmlockdVG %s init failed: no disk space for leasesVG %s start failed: lvmlockd is not enabledVG %s start failed: lvmlockd is not runninglockd start VG %s lock_type %s init %dVG %s start failed: lvmlockd not availableVG %s start error: already startedVG %s start error: already startingVG %s start failed: invalid parameters for %sVG %s start failed: invalid sanlock host_id, set in lvmlocal.confVG %s start failed: lock manager %s is not runningVG %s start failed: lock manager %s is not supported by lvmlockdVG %s stop failed: LVs must first be deactivatedlockd_stop_vg deactivate sanlock lvMissing global lock: global lock was lost by removing a previous VG.To enable the global lock in another VG, see lvmlockctl --gl-enable.Cannot create VG with lock_type %s without lvmlockd.Global lock failed: check that lvmlockd is running.Global lock failed: start existing sanlock VGs to access global lock.(If all sanlock VGs are started, enable global lock with lvmlockctl.)Global lock failed: check that VG holding global lock exists and is started.Global lock failed: check that global lockspace is started.Start a lock manager, lvmlockd did not find one running.Global lock failed: lockspace is starting.Global lock failed: held by other host.VG create failed: lock manager %s is not supported by lvmlockd.Exclusive locks are not allowed with readonly option.Unknown lvmlockd global lock modeReading without shared global lock.lockd global mode %s already held.Global lock failed: lockspace is startingGlobal lock failed: check that global lockspace is startedGlobal lock failed: storage errors for sanlock leasesGlobal lock failed: storage failed for sanlock leasesSkipping global lock: lockspace is startingSkipping global lock: storage %s for sanlock leasesSkipping global lock: VG with global lock was removedSkipping global lock: lockspace not found or startedDuplicate sanlock global locks should be correctedVG %s lock skipped: lock start in progressVG %s lock failed: lock start in progressVG %s lock skipped: storage %s for sanlock leasesVG %s lock failed: storage %s for sanlock leasesVG %s lock skipped: held by other host.VG %s lock failed: held by other host.Duplicate sanlock global lock in VG %sLV locks are not allowed with readonly option.Lock query failed for LV %s/%squery_lock_lv lvmlockd result %dquery_lock_lv mode not returnedWARNING: shared LV may require refresh on other hosts where it is active.Shared activation not compatible with LV type %s of %s/%slockd LV %s/%s mode %s uuid %sFail to find any PVs for %s/%s, try to find PVs from VG insteadFail to allocate PV list for %s/%sFail to allocate PV path for LV %s/%sFind PV device %s for LV %s/%sLV locked by other host: %s/%sWARNING: extending LV with a shared lock, other hosts may require LV refresh.LV is already locked with incompatible mode: %s/%sLV %s/%s lock failed: lockspace is inactiveLV %s/%s lock failed: storage %s for sanlock leasesLV %s/%s lock failed: error %dLV in VG %s with lock_type %s requires lvmlockd.Cannot find thin pool for %s/%sLock on incorrect thin lv type %s/%sLock on incorrect vdo lv type %s/%sLV path too long for lvmlockd refresh.Lock already exists for LV %s/%sNo sanlock space for lock for LV %s/%s_init_lv_sanlock lvmlockd result %dlv_lock_args allocation failedlockd_init_lv: unknown lock_type.Cannot create snapshot without origin LV in shared VG.Failed to find origin LV %s/%sFailed to lock origin LV %s/%sFailed to find thin pool %s/%sFailed to lock thin pool %s/%sCreate thin pool and thin LV separately with lock type %sUnknown thin options for lock init.lockd_free_lv: unknown lock_type.Failed to restart VG %s lockspace.lockd_rename_vg_final lvmlockd result %dFailed to start VG %s lockspace.Failed to get result from lvmlockdFailed to find a running lock manager.LV %s/%s must be inactive on all hosts.Cannot change VG %s with active LVsGlobal lock failed: global lock was lost by removing a previous VG._free_vg_sanlock %s no lock_args_free_vg_sanlock lvmlockd result %dVG %s held the sanlock global lock, enable global lock in another VG.LVs must be inactive before vgrename.Cannot rename VG %s with active LVslockd_rename_vg_before lvmlockd result %dlockd_rename_vg_before deactivate sanlock lvRefreshing LV %s on other hosts...Failed to refresh LV on all hosts.Manual lvchange --refresh required on all hosts for %s.hȆԍԍčԍč`_free_vg_busy_vgvdo_poolvdo/vdo.cvdo_offset Virtual size %s Header size %sCompression %s %sDeduplicationMetadata hints Minimum IO size %s Block map cache sz %s Block map era length %uSparse index Index memory size %s Slab size %s # Ack threads %u # Bio threads %u Bio rotation %u # CPU threads %u # Hash zone threads %u # Logical threads %u # Physical threads %u Max discard %u Write policy %sonline_renameUnknown logical volume %s.vdo_pool = "%s"vdo_offset = %uheader_size = %uvirtual_extents = %uuse_compression = 1use_deduplication = 1use_metadata_hints = 1minimum_io_size = %ublock_map_cache_size_mb = %ublock_map_era_length = %uuse_sparse_index = 1index_memory_size_mb = %umax_discard = %uslab_size_mb = %uack_threads = %ubio_threads = %ubio_rotation = %ucpu_threads = %uhash_zone_threads = %ulogical_threads = %uphysical_threads = %uwrite_policy = %sInitialised segtypes: %s, %s.Couldn't read '%s' for VDO segment.Unknown VDO pool logical volume %s.String list allocation failed for VDO module.WARNING: Target %s version %u.%u.%u is too old.Target %s %s support disabled by %s.Internal error: Passed segment is not VDO pool.Internal error: Passed segment is not VDO type.Failed to allocate memory for VDO segtypes.global/vdo_disabled_featureskvdo ...command.cTagSelectDESC: %s _long--uuidstr prev OO:OO_OP:Cannot find command %s.lvreduceOO_ALL:AUTOTYPE:FLAGS:SECONDARY_SYNTAXPREVIOUS_SYNTAXRULE:Parsing command defs: no mem.LV_lv_is_ID:Failer to duplicate name %s.Failer to duplicate line %s.IO:OO_ALL -%c|%s (, %c%c [ --type %s ] (implied)[ --type %s|%s ] (implied) [ -l|--extents [ COMMON_OPTIONS ] [ Common options for lvm: Common options for command:devtypesdumpconfigformatsfullreportDisplay full reportDisplay help for commandslastlogChange logical volume layoutCreate a logical volumelvdisplayAdd space to a logical volumelvmchangelvmconfiglvmdevicesManage the devices filelvmdiskscanlvmsadcCollect activity datalvmsarCreate activity reportlvpolllvrenameRename a logical volumeResize a logical volumelvscanpvchangepvckpvdatapvdisplaypvremovepvresizeResize physical volume(s)pvscanList all physical volumessegtypesList available segment typesvgcfgbackupvgcfgrestorevgchangevgckvgconvertCreate a volume groupvgdisplayvgexportvgextendvgimportvgimportcloneImport a VG from cloned PVsvgimportdevicesvgmergeMerge volume groupsvgmknodesvgreduceRemove volume group(s)vgrenameRename a volume groupvgsvgscanSearch for all volume groupsvgsplitCMD_NONEdevtypes_general_CMDdevtypes_generalformats_general_CMDformats_generalfullreport_general_CMDfullreport_generalhelp_general_CMDhelp_generallastlog_general_CMDlastlog_generallvchange_activate_CMDlvchange_activatelvchange_monitor_CMDlvchange_monitorlvchange_persistent_CMDlvchange_persistentlvchange_poll_CMDlvchange_polllvchange_properties_CMDlvchange_propertieslvchange_rebuild_CMDlvchange_rebuildlvchange_refresh_CMDlvchange_refreshlvchange_resync_CMDlvchange_resynclvchange_syncaction_CMDlvchange_syncactionlvconvert_change_mirrorloglvconvert_change_region_sizelvconvert_integrity_CMDlvconvert_integritylvconvert_merge_CMDlvconvert_mergelvconvert_merge_mirror_imageslvconvert_merge_snapshot_CMDlvconvert_merge_snapshotlvconvert_merge_thin_CMDlvconvert_merge_thinlvconvert_plain_CMDlvconvert_plainlvconvert_raid_types_CMDlvconvert_raid_typeslvconvert_repair_CMDlvconvert_repairlvconvert_replace_pv_CMDlvconvert_replace_pvlvconvert_split_cow_snapshotlvconvert_split_mirror_imageslvconvert_start_poll_CMDlvconvert_start_polllvconvert_swap_pool_metadatalvconvert_to_cachepool_CMDlvconvert_to_cachepoollvconvert_to_thinpool_CMDlvconvert_to_thinpoollvconvert_to_vdopool_CMDlvconvert_to_vdopoollvconvert_to_vdopool_paramlvconvert_to_writecache_CMDlvconvert_to_writecachelvcreate_and_attach_cachepoollvcreate_cachepool_CMDlvcreate_cachepoollvcreate_cow_snapshot_CMDlvcreate_cow_snapshotlvcreate_error_vol_CMDlvcreate_error_vollvcreate_linear_CMDlvcreate_linearlvcreate_mirror_CMDlvcreate_mirrorlvcreate_mirror_or_raid1_CMDlvcreate_mirror_or_raid1lvcreate_raid_any_CMDlvcreate_raid_anylvcreate_striped_CMDlvcreate_stripedlvcreate_thin_snapshot_CMDlvcreate_thin_snapshotlvcreate_thin_vol_CMDlvcreate_thin_vollvcreate_thinpool_CMDlvcreate_thinpoollvcreate_vdo_vol_CMDlvcreate_vdo_vollvcreate_zero_vol_CMDlvcreate_zero_vollvdisplay_general_CMDlvdisplay_generallvextend_by_policy_CMDlvextend_by_policylvextend_by_pv_CMDlvextend_by_pvlvextend_by_size_CMDlvextend_by_sizelvmchange_general_CMDlvmchange_generallvmconfig_general_CMDlvmconfig_generallvmdevices_check_CMDlvmdevices_checklvmdevices_edit_CMDlvmdevices_editlvmdevices_list_CMDlvmdevices_listlvmdevices_update_CMDlvmdevices_updatelvmdiskscan_general_CMDlvmdiskscan_generallvmsadc_general_CMDlvmsadc_generallvmsar_general_CMDlvmsar_generallvpoll_general_CMDlvpoll_generallvreduce_general_CMDlvreduce_generallvremove_general_CMDlvremove_generallvrename_lv_lv_CMDlvrename_lv_lvlvrename_vg_lv_lv_CMDlvrename_vg_lv_lvlvresize_by_pv_CMDlvresize_by_pvlvresize_by_size_CMDlvresize_by_sizelvs_general_CMDlvs_generallvscan_general_CMDlvscan_generalpvchange_properties_all_CMDpvchange_properties_allpvchange_properties_some_CMDpvchange_properties_somepvck_dump_CMDpvck_dumppvck_general_CMDpvck_generalpvck_repair_CMDpvck_repairpvck_repair_type_CMDpvck_repair_typepvcreate_general_CMDpvcreate_generalpvdata_general_CMDpvdata_generalpvdisplay_general_CMDpvdisplay_generalpvmove_any_CMDpvmove_anypvmove_one_CMDpvmove_onepvremove_general_CMDpvremove_generalpvresize_general_CMDpvresize_generalpvs_general_CMDpvs_generalpvscan_cache_CMDpvscan_cachepvscan_display_CMDpvscan_displaysegtypes_general_CMDsegtypes_generalsystemid_general_CMDsystemid_generaltags_general_CMDtags_generalversion_general_CMDversion_generalvgcfgbackup_general_CMDvgcfgbackup_generalvgcfgrestore_by_file_CMDvgcfgrestore_by_filevgcfgrestore_by_vg_CMDvgcfgrestore_by_vgvgcfgrestore_list_by_file_CMDvgcfgrestore_list_by_filevgcfgrestore_list_by_vg_CMDvgcfgrestore_list_by_vgvgchange_activate_CMDvgchange_activatevgchange_lockstart_CMDvgchange_lockstartvgchange_lockstop_CMDvgchange_lockstopvgchange_locktype_CMDvgchange_locktypevgchange_monitor_CMDvgchange_monitorvgchange_poll_CMDvgchange_pollvgchange_properties_CMDvgchange_propertiesvgchange_refresh_CMDvgchange_refreshvgchange_systemid_CMDvgchange_systemidvgck_general_CMDvgck_generalvgck_update_metadata_CMDvgck_update_metadatavgconvert_general_CMDvgconvert_generalvgcreate_general_CMDvgcreate_generalvgdisplay_general_CMDvgdisplay_generalvgexport_all_CMDvgexport_allvgexport_some_CMDvgexport_somevgextend_general_CMDvgextend_generalvgimport_all_CMDvgimport_allvgimport_some_CMDvgimport_somevgimportclone_general_CMDvgimportclone_generalvgimportdevices_all_CMDvgimportdevices_allvgimportdevices_some_CMDvgimportdevices_somevgmerge_general_CMDvgmerge_generalvgmknodes_general_CMDvgmknodes_generalvgreduce_all_CMDvgreduce_allvgreduce_by_pv_CMDvgreduce_by_pvvgreduce_missing_CMDvgreduce_missingvgremove_general_CMDvgremove_generalvgrename_by_name_CMDvgrename_by_namevgrename_by_uuid_CMDvgrename_by_uuidvgs_general_CMDvgs_generalvgscan_general_CMDvgscan_generalvgsplit_by_lv_CMDvgsplit_by_lvvgsplit_by_pv_CMDvgsplit_by_pvCMD_COUNTLVT_NONElinear_LVTstriped_LVTsnapshot_LVTthin_LVTthinpool_LVTcachepool_LVTvdo_LVTvdopool_LVTvdopooldata_LVTvdopooldatamirror_LVTraid_LVTraid0_LVTraid1_LVTraid4_LVTraid5_LVTraid6_LVTraid10_LVTerror_LVTzero_LVTwritecache_LVTintegrity_LVTLVT_COUNTLVP_NONEis_locked_LVPlv_is_lockedis_partial_LVPlv_is_partialis_virtual_LVPlv_is_virtualis_merging_LVPlv_is_mergingis_merging_origin_LVPlv_is_merging_originis_converting_LVPlv_is_convertingis_external_origin_LVPlv_is_external_originis_virtual_origin_LVPlv_is_virtual_originis_not_synced_LVPlv_is_not_syncedis_pending_delete_LVPlv_is_pending_deleteis_error_when_full_LVPlv_is_error_when_fullis_pvmove_LVPlv_is_pvmoveis_removed_LVPlv_is_removedis_vg_writable_LVPlv_is_vg_writableis_thinpool_data_LVPlv_is_thinpool_datais_thinpool_metadata_LVPlv_is_thinpool_metadatais_cachepool_data_LVPlv_is_cachepool_datais_cachepool_metadata_LVPlv_is_cachepool_metadatais_mirror_image_LVPlv_is_mirror_imageis_mirror_log_LVPlv_is_mirror_logis_raid_image_LVPlv_is_raid_imageis_raid_metadata_LVPlv_is_raid_metadatais_origin_LVPlv_is_originis_thick_origin_LVPlv_is_thick_originis_thick_snapshot_LVPlv_is_thick_snapshotis_thin_origin_LVPlv_is_thin_originis_thin_snapshot_LVPlv_is_thin_snapshotis_cache_origin_LVPlv_is_cache_originis_merging_cow_LVPlv_is_merging_cowis_cow_covering_origin_LVPlv_is_cow_covering_originis_visible_LVPlv_is_visibleis_historical_LVPlv_is_historicalis_raid_with_tracking_LVPlv_is_raid_with_trackingis_raid_with_integrity_LVPlv_is_raid_with_integrityLVP_COUNTARG_UNUSEDabort_ARG--abortactivationmode_ARG--activationmodeaddtag_ARG--addtagadddev_ARG--adddevdeldev_ARG--deldevaddpvid_ARG--addpviddelpvid_ARG--delpvidaligned_ARG--alignedalloc_ARG--allocatomic_ARG--atomicatversion_ARG--atversionsetautoactivation_ARG--setautoactivationbinary_ARG--binarybootloaderareasize_ARG--bootloaderareasizecache_long_ARG--cachecachemetadataformat_ARG--cachemetadataformatcachemode_ARG--cachemodecachepool_ARG--cachepoolThe name of a cache pool. cachevol_ARG--cachevolThe name of a cache volume. cachedevice_ARG--cachedevicecachesize_ARG--cachesizeThe size of cache to use. check_ARG--checkcommandprofile_ARG--commandprofilecompression_ARG--compression--configconfigreport_ARG--configreportSee \fBlvmreport\fP(7). configtype_ARG--typeconfigdataalignment_ARG--dataalignmentdataalignmentoffset_ARG--dataalignmentoffsetdeduplication_ARG--deduplicationdeltag_ARG--deltagdetachprofile_ARG--detachprofiledeviceidtype_ARG--deviceidtype--devicesdevicesfile_ARG--devicesfilediscards_ARG--discardsdriverloaded_ARG--driverloadeddump_ARG--dumperrorwhenfull_ARG--errorwhenfullforce_long_ARGforeign_ARG--foreignhandlemissingpvs_ARG--handlemissingpvsignoreadvanced_ARG--ignoreadvancedignorelocal_ARG--ignorelocalignorelockingfailure_ARG--ignorelockingfailureignoremonitoring_ARG--ignoremonitoringignoreskippedcluster_ARG--ignoreskippedclusterNo longer used. ignoreunsupported_ARG--ignoreunsupportedimportdevices_ARG--importdevicesjournal_ARG--journallabelsector_ARG--labelsectorlistlvs_ARG--listlvslistvg_ARG--listvgcheckcomplete_ARG--checkcompletelockopt_ARG--lockoptlockstart_ARG--lockstartlockstop_ARG--lockstoplocktype_ARG--locktypelogonly_ARG--logonlylonghelp_ARG--longhelpDisplay long help text. --maxrecoveryratemerge_ARG--mergemergemirrors_ARG--mergemirrorsmergesnapshot_ARG--mergesnapshotmergethin_ARG--mergethinmergedconfig_ARG--mergedconfigmetadataignore_ARG--metadataignoremetadataprofile_ARG--metadataprofile--metadatasizeminor_ARG--minor--minrecoveryratemirrorlog_ARG--mirrorlogmirrorsonly_ARG--mirrorsonlymknodes_ARG--mknodesmonitor_ARG--monitornameprefixes_ARG--nameprefixesnoheadings_ARG--noheadingsnohints_ARG--nohintsnohistory_ARG--nohistorynolocking_ARG--nolockingDisable locking. norestorefile_ARG--norestorefilenosuffix_ARG--nosuffixnosync_ARG--nosyncnotifydbus_ARG--notifydbusnoudevsync_ARG--noudevsyncoriginname_ARG--originnamesetphysicalvolumesize_ARG--setphysicalvolumesize--settings--pollpolloperation_ARG--polloperationpooldatasize_ARG--pooldatasizepoolmetadata_ARG--poolmetadatapoolmetadatasize_ARG--poolmetadatasizepoolmetadataspare_ARG--poolmetadataspare--profilepvmetadatacopies_ARG--pvmetadatacopiesraidintegrity_ARG--raidintegrityraidintegrityblocksize_ARG--raidintegrityblocksizeraidintegritymode_ARG--raidintegritymodereadonly_ARG--readonlyrefresh_ARG--refreshremovemissing_ARG--removemissing--rebuildrepair_ARG--repairrepairtype_ARG--repairtypereplace_ARG--replacereportformat_ARG--reportformat--restorefilerestoremissing_ARG--restoremissingresync_ARG--resyncrows_ARG--rowsOutput columns as rows. segments_ARG--segmentsseparator_ARG--separatorshared_ARG--sharedsinceversion_ARG--sinceversionsplitcache_ARG--splitcachesplitmirrors_ARG--splitmirrorssplitsnapshot_ARG--splitsnapshotshowdeprecated_ARG--showdeprecatedshowunsupported_ARG--showunsupportedstartpoll_ARG--startpollstripes_long_ARGswapmetadata_ARG--swapmetadata--syncactionsysinit_ARG--sysinitsystemid_ARG--systemidthinpool_ARG--thinpoolThe name of a thin pool LV. trackchanges_ARG--trackchangestrustcache_ARG--trustcache--typeudevoutput_ARG--udevoutputunbuffered_ARG--unbuffereduncache_ARG--uncacheupdate_ARG--updatecachepolicy_ARG--cachepolicycachesettings_ARG--cachesettingsunconfigured_ARG--unconfiguredunits_ARG--unitsunquoted_ARG--unquotedusepolicies_ARG--usepoliciesvalidate_ARG--validatevdo_ARG--vdovdopool_ARG--vdopoolvdosettings_ARG--vdosettings--versionDisplay version information. vgmetadatacopies_ARG--vgmetadatacopiesvgonline_ARG--vgonlinewithsummary_ARG--withsummarywithcomments_ARG--withcommentswithgeneralpreamble_ARG--withgeneralpreamblewithlocalpreamble_ARG--withlocalpreamblewithspaces_ARG--withspaceswithversions_ARG--withversions--writebehind--writemostlycorelog_ARG--corelogresizable_ARG--resizableallocation_ARG--allocationavailable_ARG--availableraidrebuild_ARG--raidrebuildraidsyncaction_ARG--raidsyncactionraidwritemostly_ARG--raidwritemostlyraidminrecoveryrate_ARG--raidminrecoveryrateraidmaxrecoveryrate_ARG--raidmaxrecoveryrateraidwritebehind_ARG--raidwritebehindvirtualoriginsize_ARG--virtualoriginsizesplit_ARG--split--metadatacopiesactivate_ARG--activateall_ARG--allautobackup_ARG--autobackupactivevolumegroups_ARG--activevolumegroupsbackground_ARG--backgroundbasevgname_ARG--basevgnameblockdevice_ARG--blockdevicechunksize_ARG--chunksizeclustered_ARG--clusteredcolon_ARG--coloncolumns_ARG--columnscontiguous_ARG--contiguousdebug_ARG--debugexported_ARG--exportedphysicalextent_ARG--physicalextent--fileforce_ARG--full--helpDisplay help text. --historyhelp2_ARGimport_ARG--importinterval_ARG--intervaliop_version_ARG--iop_versionstripes_ARGstripesize_ARGlogicalvolume_ARG--logicalvolumemaxlogicalvolumes_ARG--maxlogicalvolumesextents_ARG--extents--listlvmpartition_ARG--lvmpartitionOnly report PVs. --sizepersistent_ARG--persistentmajor_ARG--majorsetactivationskip_ARG--setactivationskipignoreactivationskip_ARG--ignoreactivationskipmaps_ARG--maps--mirrorsmetadatatype_ARG--metadatatype--namenofsck_ARG--nofscknovolumegroup_ARG--novolumegroupoldpath_ARG--oldpathoptions_ARG--optionssort_ARG--sortmaxphysicalvolumes_ARG--maxphysicalvolumespermission_ARG--permissionpartial_ARG--partialphysicalvolume_ARG--physicalvolumequiet_ARG--quietreadahead_ARG--readaheadresizefs_ARG--resizefsreset_ARG--resetregionsize_ARGphysicalextentsize_ARG--physicalextentsize--snapshotshort_ARG--shortstdin_ARG--stdinselect_ARG--selecttest_ARG--test--thinupdatemetadata_ARG--updatemetadatauuid_ARG--uuiduuidstr_ARGuuidlist_ARG--uuidlistverbose_ARG--volumegroupvirtualsize_ARG--virtualsizewipesignatures_ARG--wipesignaturesallocatable_ARG--allocatableresizeable_ARG--resizeableyes_ARGzero_ARG--zeroARG_COUNTnone_VALERRconststr_VALConstStringconstnum_VALConstNumberbool_VALBooly|nsnumber_VALSNumber[+|-]Numberpnumber_VALPNumber[+]Numberuint32_VALUint32string_VALvg_VALlv_VALpv_VALtag_VALselect_VALactivationmode_VALActivationModepartial|degraded|completeactivation_VALActivey|n|aycachemetadataformat_VALCacheMetadataFormatauto|1|2cachemode_VALCacheModediscards_VALDiscardspassdown|nopassdown|ignoremirrorlog_VALMirrorLogcore|diskssizekb_VALSSizeKB[+|-]Size[k|UNIT]ssizemb_VALSSizeMB[+|-]Size[m|UNIT]psizemb_VALPSizeMB[+]Size[m|UNIT]NSizeMB[-]Size[m|UNIT]regionsizemb_VALRegionSizesextents_VALSExtents[+|-]Number[PERCENT]pextents_VALPExtents[+]Number[PERCENT]nextents_VALNExtents[-]Number[PERCENT]permission_VALPermissionrw|rmetadatatype_VALMetadataTypeunits_VALUnitssegtype_VALSegTypealloc_VALAlloclocktype_VALLockTypesanlock|dlm|nonereadahead_VALReadaheadauto|none|Numbervgmetadatacopies_VALMetadataCopiesVGall|unmanaged|Numberpvmetadatacopies_VALMetadataCopiesPV0|1|2unusedpolloperation_VALPollOpwritemostly_VALWriteMostlyPVPV[:t|n|y]syncaction_VALSyncActioncheck|repairreportformat_VALReportFmtbasic|jsonconfigreport_VALConfigReportlog|vg|lv|pv|pvseg|segconfigtype_VALConfigTyperepairtype_VALRepairTypedumptype_VALDumpTypeVAL_COUNTParsing command defs: options must be specified in long form: %s.Parsing command defs: unknown lv type %s.Parsing command defs: unknown pos arg: %s.Parsing command defs: unknown opt str: "%s"%s%s.Parsing command defs: unknown opt arg: %s.Parsing command defs: option %s must be followed by an arg.Parsing command defs: can't parse argc %d argv %s%s%s.Parsing command defs: no OO line found for %s.File cmds.h has unsorted name entry %s.File commands.h has unsorted name entry %s.Parsing command defs: too many rules for cmd.Parsing command defs: unknown lv property %s.Parsing command defs: invalid OO definition.Parsing command defs: no memory.Parsing command defs: can't process input line %s. Special options for command: [ --extents Number[PERCENT] ] The --extents option can be used in place of --size. The number allows an optional percent suffix. [ --name String ] The --name option is not required but is typically used. When a name is not specified, a new LV name is generated with the "lvol" prefix and a unique numeric suffix. Common variables for lvm: Variables in option or position args are capitalized, e.g. PV, VG, LV, Size, Number, String, Tag. PV Physical Volume name, a device path under /dev. For commands managing physical extents, a PV positional arg generally accepts a suffix indicating a range (or multiple ranges) of PEs. When the first PE is omitted, it defaults to the start of the device, and when the last PE is omitted it defaults to the end. PV[:PE-PE]... is start and end range (inclusive), PV[:PE+PE]... is start and length range (counting from 0). LV Logical Volume name. See lvm(8) for valid names. An LV positional arg generally includes the VG name and LV name, e.g. VG/LV. LV followed by _ indicates that an LV of the given type is required. (raid represents raid type). The _new suffix indicates that the LV name is new. Tag Tag name. See lvm(8) for information about tag names and using tags in place of a VG, LV or PV. Select Select indicates that a required positional arg can be omitted if the --select option is used. No arg appears in this position. Size[UNIT] Size is an input number that accepts an optional unit. Input units are always treated as base two values, regardless of capitalization, e.g. 'k' and 'K' both refer to 1024. The default input unit is specified by letter, followed by |UNIT. UNIT represents other possible input units: BbBsSkKmMgGtTpPeE. (This should not be confused with the output control --units, where capital letters mean multiple of 1000.)Display and manipulate configuration informationDisplay recognised built-in block device typesList available metadata formatsDisplay last command's log reportChange the attributes of logical volume(s)Display information about a logical volumeWith the device mapper, this is obsolete and does nothing.List devices that may be used as physical volumesContinue already initiated poll operation on a logical volumeReduce the size of a logical volumeRemove logical volume(s) from the systemDisplay information about logical volumesList all logical volumes in all volume groupsChange attributes of physical volume(s)Check metadata on physical volumesInitialize physical volume(s) for use by LVMDisplay the on-disk metadata for physical volume(s)Display various attributes of physical volume(s)Move extents from one physical volume to anotherRemove LVM label(s) from physical volume(s)Display information about physical volumesDisplay the system ID, if any, currently set on this hostList tags defined on this hostDisplay software and driver version informationBackup volume group configuration(s)Restore volume group configurationChange volume group attributesCheck the consistency of volume group(s)Change volume group metadata formatDisplay volume group informationUnregister volume group(s) from the systemAdd physical volumes to a volume groupRegister exported volume group with systemAdd devices for a VG to the devices file.Create the special files for volume group devices in /devRemove physical volume(s) from a volume groupDisplay information about volume groupsMove physical volumes into a new or existing volume grouplvconvert_change_mirrorlog_CMDlvconvert_change_region_size_CMDlvconvert_combine_split_snapshot_CMDlvconvert_combine_split_snapshotlvconvert_merge_mirror_images_CMDlvconvert_split_and_keep_cache_CMDlvconvert_split_and_keep_cachelvconvert_split_and_remove_cache_CMDlvconvert_split_and_remove_cachelvconvert_split_cow_snapshot_CMDlvconvert_split_mirror_images_CMDlvconvert_swap_pool_metadata_CMDlvconvert_to_cache_with_cachepool_CMDlvconvert_to_cache_with_cachepoollvconvert_to_cache_with_cachevol_CMDlvconvert_to_cache_with_cachevollvconvert_to_cache_with_device_CMDlvconvert_to_cache_with_devicelvconvert_to_cachepool_or_swap_metadata_CMDlvconvert_to_cachepool_or_swap_metadatalvconvert_to_thin_with_external_CMDlvconvert_to_thin_with_externallvconvert_to_thinpool_or_swap_metadata_CMDlvconvert_to_thinpool_or_swap_metadatalvconvert_to_vdopool_param_CMDlvconvert_to_writecache_with_device_CMDlvconvert_to_writecache_with_devicelvcreate_and_attach_cachedevice_for_cache_CMDlvcreate_and_attach_cachedevice_for_cachelvcreate_and_attach_cachedevice_for_writecache_CMDlvcreate_and_attach_cachedevice_for_writecachelvcreate_and_attach_cachepool_CMDlvcreate_and_attach_cachepool_v2_CMDlvcreate_and_attach_cachepool_v2lvcreate_and_attach_cachepool_v3_CMDlvcreate_and_attach_cachepool_v3lvcreate_and_attach_cachevol_for_cache_CMDlvcreate_and_attach_cachevol_for_cachelvcreate_and_attach_cachevol_for_writecache_CMDlvcreate_and_attach_cachevol_for_writecachelvcreate_cow_snapshot_with_virtual_origin_CMDlvcreate_cow_snapshot_with_virtual_originlvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepool_CMDlvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepoollvcreate_thin_snapshot_of_external_CMDlvcreate_thin_snapshot_of_externallvcreate_thin_vol_and_thinpool_CMDlvcreate_thin_vol_and_thinpoollvcreate_thin_vol_with_thinpool_or_sparse_snapshot_CMDlvcreate_thin_vol_with_thinpool_or_sparse_snapshotlvextend_pool_metadata_by_size_CMDlvextend_pool_metadata_by_sizelvresize_pool_metadata_by_size_CMDlvresize_pool_metadata_by_size#pvmove Abort any pvmove operations in progress. If a pvmove was started with the --atomic option, then all LVs will remain on the source PV. Otherwise, segments that have been moved will remain on the destination PV, while unmoved segments will remain on the source PV. #lvpoll Stop processing a poll operation in lvmpolld. Determines if LV activation is allowed when PVs are missing, e.g. because of a device failure. \fBcomplete\fP only allows LVs with no missing PVs to be activated, and is the most restrictive mode. \fBdegraded\fP allows RAID LVs with missing PVs to be activated. (This does not include the "mirror" type, see "raid1" instead.) \fBpartial\fP allows any LV with missing PVs to be activated, and should only be used for recovery or repair. For default, see \fBlvm.conf\fP(5) activation_mode. See \fBlvmraid\fP(7) for more information. Adds a tag to a PV, VG or LV. This option can be repeated to add multiple tags at once. See \fBlvm\fP(8) for information about tags. Add a device to the devices file. Remove a device from the devices file. Find a device with the PVID and add the device to the devices file. Remove a device with the PVID from the devices file. Use with --separator to align the output columns Determines the allocation policy when a command needs to allocate Physical Extents (PEs) from the VG. Each VG and LV has an allocation policy which can be changed with vgchange/lvchange, or overridden on the command line. \fBnormal\fP applies common sense rules such as not placing parallel stripes on the same PV. \fBinherit\fP applies the VG policy to an LV. \fBcontiguous\fP requires new PEs be placed adjacent to existing PEs. \fBcling\fP places new PEs on the same PV as existing PEs in the same stripe of the LV. If there are sufficient PEs for an allocation, but normal does not use them, \fBanywhere\fP will use them even if it reduces performance, e.g. by placing two stripes on the same PV. Optional positional PV args on the command line can also be used to limit which PVs the command will use for allocation. See \fBlvm\fP(8) for more information about allocation. Makes a pvmove operation atomic, ensuring that all affected LVs are moved to the destination PV, or none are if the operation is aborted. Specify an LVM version in x.y.z format where x is the major version, the y is the minor version and z is the patchlevel (e.g. 2.2.106). When configuration is displayed, the configuration settings recognized at this LVM version will be considered only. This can be used to display a configuration that a certain LVM version understands and which does not contain any newer settings for which LVM would issue a warning message when checking the configuration. Set the autoactivation property on a VG or LV. Display the property with vgs or lvs "-o autoactivation". When the autoactivation property is disabled, the VG or LV will not be activated by a command doing autoactivation (vgchange, lvchange, or pvscan using -aay.) If autoactivation is disabled on a VG, no LVs will be autoactivated in that VG, and the LV autoactivation property has no effect. If autoactivation is enabled on a VG, autoactivation can be disabled for individual LVs. Use binary values "0" or "1" instead of descriptive literal values for columns that have exactly two valid values to report (not counting the "unknown" value which denotes that the value could not be determined). Reserve space for the bootloader between the LVM metadata area and the first PE. The bootloader area is reserved for bootloaders to embed their own data or metadata; LVM will not use it. The bootloader area begins where the first PE would otherwise be located. The first PE is moved out by the size of the bootloader area, and then moved out further if necessary to match the data alignment. The start of the bootloader area is always aligned, see also --dataalignment and --dataalignmentoffset. The bootloader area may be larger than requested due to the alignment, but it's never less than the requested size. To see the bootloader area start and size of an existing PV use pvs -o +pv_ba_start,pv_ba_size. #pvscan Scan one or more devices and record that they are online. #vgscan This option is no longer used. #lvscan This option is no longer used. Specifies the cache metadata format used by cache target. Specifies when writes to a cache LV should be considered complete. \fBwriteback\fP considers a write complete as soon as it is stored in the cache pool. \fBwritethough\fP considers a write complete only when it has been stored in both the cache pool and on the origin LV. While writethrough may be slower for writes, it is more resilient if something should happen to a device associated with the cache pool LV. With \fBpassthrough\fP, all reads are served from the origin LV (all reads miss the cache) and all writes are forwarded to the origin LV; additionally, write hits cause cache block invalidates. See \fBlvmcache\fP(7) for more information. The name of a device to use for a cache. Checks the content of the devices file. Reports incorrect device names or PVIDs for entries. The command profile to use for command configuration. See \fBlvm.conf\fP(5) for more information about profiles. Controls whether compression is enabled or disable for VDO volume. See \fBlvmvdo\fP(7) for more information about VDO usage. Config settings for the command. These override \fBlvm.conf\fP(5) settings. The String arg uses the same format as \fBlvm.conf\fP(5), or may use section/field syntax. See \fBlvm.conf\fP(5) for more information about config. \fBcurrent\fP prints the config settings that would be applied to an lvm command (assuming the command does not override them on the command line.) This includes: settings that have been modified in lvm config files, settings that get their default values from config files, and default settings that have been uncommented in config files. \fBdefault\fP prints all settings with their default values. Changes made in lvm config files are not reflected in the output. Some settings get their default values internally, and these settings are printed as comments. Other settings get their default values from config files, and these settings are not printed as comments. \fBdiff\fP prints only config settings that have been modified from their default values in config files (the difference between current and default.) \fBfull\fP prints every setting uncommented and set to the current value, i.e. how it would be used by an lvm command. This includes settings modified in config files, settings that usually get defaults internally, and settings that get defaults from config files. \fBlist\fP prints all config names without values. \fBmissing\fP prints settings that are missing from the lvm config files. A missing setting that usually gets its default from config files is printed uncommented and set to the internal default. Settings that get their default internally and are not set in config files are printed commented with the internal default. \fBnew\fP prints config settings that have been added since the lvm version specified by --sinceversion. They are printed with their default values. \fBprofilable\fP prints settings with their default values that can be set from a profile. \fBprofilable-command\fP prints settings with their default values that can be set from a command profile. \fBprofilable-metadata\fP prints settings with their default values that can be set from a metadata profile. Also see \fBlvm.conf\fP(5). Align the start of a PV data area with a multiple of this number. To see the location of the first Physical Extent (PE) of an existing PV, use pvs -o +pe_start. In addition, it may be shifted by an alignment offset, see --dataalignmentoffset. Also specify an appropriate PE size when creating a VG. Shift the start of the PV data area by this additional offset. Controls whether deduplication is enabled or disable for VDO volume. See \fBlvmvdo\fP(7) for more information about VDO usage. Deletes a tag from a PV, VG or LV. This option can be repeated to delete multiple tags at once. See \fBlvm\fP(8) for information about tags. Detaches a metadata profile from a VG or LV. See \fBlvm.conf\fP(5) for more information about profiles. The type of device ID to use for the device. If the specified type is available for the device, then it will override the default type that lvm would use. Restricts the devices that are visible and accessible to the command. Devices not listed will appear to be missing. This option can be repeated, or accepts a comma separated list of devices. This overrides the devices file. A file listing devices that LVM should use. The file must exist in \fI#DEFAULT_SYS_DIR#/devices/\fP and is managed with the \fBlvmdevices\fP(8) command. This overrides the \fBlvm.conf\fP(5) \fBdevices/devicesfile\fP and \fBdevices/use_devicesfile\fP settings. Specifies how the device-mapper thin pool layer in the kernel should handle discards. \fBignore\fP causes the thin pool to ignore discards. \fBnopassdown\fP causes the thin pool to process discards itself to allow reuse of unneeded extents in the thin pool. \fBpassdown\fP causes the thin pool to process discards itself (like nopassdown) and pass the discards to the underlying device. See \fBlvmthin\fP(7) for more information. If set to no, the command will not attempt to use device-mapper. For testing and debugging. Dump headers and metadata from a PV for debugging and repair. Option values include: \fBheaders\fP to print and check LVM headers, \fBmetadata\fP to print or save the current text metadata, \fBmetadata_all\fP to list or save all versions of metadata, \fBmetadata_search\fP to list or save all versions of metadata, searching standard locations in case of damaged headers, \fBmetadata_area\fP to save an entire text metadata area to a file. Specifies thin pool behavior when data space is exhausted. When yes, device-mapper will immediately return an error when a thin pool is full and an I/O request requires space. When no, device-mapper will queue these I/O requests for a period of time to allow the thin pool to be extended. Errors are returned if no space is available after the timeout. (Also see dm-thin-pool kernel module option no_space_timeout.) See \fBlvmthin\fP(7) for more information. Force metadata restore even with thin pool LVs. Use with extreme caution. Most changes to thin metadata cannot be reverted. You may lose data if you restore metadata that does not match the thin pool kernel metadata precisely. Report/display foreign VGs that would otherwise be skipped. See \fBlvmsystemid\fP(7) for more information about foreign VGs. Allows a polling operation to continue when PVs are missing, e.g. for repairs due to faulty devices. Exclude advanced configuration settings from the output. Ignore the local section. The local section should be defined in the lvmlocal.conf file, and should contain config settings specific to the local host which should not be copied to other hosts. Allows a command to continue with read-only metadata operations after locking failures. Do not interact with dmeventd unless --monitor is specified. Do not use this if dmeventd is already monitoring a device. Exclude unsupported configuration settings from the output. These settings are either used for debugging and development purposes only or their support is not yet complete and they are not meant to be used in production. The \fBcurrent\fP and \fBdiff\fP types include unsupported settings in their output by default, all the other types ignore unsupported settings. Add devices to the devices file. Record information in the systemd journal. This information is in addition to information enabled by the lvm.conf log/journal setting. command: record information about the command. output: record the default command output. debug: record full command debugging. By default the PV is labelled with an LVM2 identifier in its second sector (sector 1). This lets you use a different sector near the start of the disk (between 0 and 3 inclusive - see LABEL_SCAN_SECTORS in the source). Use with care. Print a list of LVs that use the device. Print the VG that uses the device. Check if all the devices used by a VG or LV are present, and print "complete" or "incomplete" for each listed VG or LV. This option is used as a part of event-based autoactivation, so pvscan will do nothing if this option is set and event_activation=0 in the config settings. Used to pass options for special cases to lvmlockd. See \fBlvmlockd\fP(8) for more information. Start the lockspace of a shared VG in lvmlockd. lvmlockd locks becomes available for the VG, allowing LVM to use the VG. See \fBlvmlockd\fP(8) for more information. Stop the lockspace of a shared VG in lvmlockd. lvmlockd locks become unavailable for the VG, preventing LVM from using the VG. See \fBlvmlockd\fP(8) for more information. #vgchange Change the VG lock type to or from a shared lock type used with lvmlockd. See \fBlvmlockd\fP(8) for more information. #vgcreate Specify the VG lock type directly in place of using --shared. See \fBlvmlockd\fP(8) for more information. Suppress command report and display only log report. Sets the maximum recovery rate for a RAID LV. The rate value is an amount of data per second for each device in the array. Setting the rate to 0 means it will be unbounded. See \fBlvmraid\fP(7) for more information. An alias for --mergethin, --mergemirrors, or --mergesnapshot, depending on the type of LV. Merge LV images that were split from a raid1 LV. See --splitmirrors with --trackchanges. Merge COW snapshot LV into its origin. When merging a snapshot, if both the origin and snapshot LVs are not open, the merge will start immediately. Otherwise, the merge will start the first time either the origin or snapshot LV are activated and both are closed. Merging a snapshot into an origin that cannot be closed, for example a root filesystem, is deferred until the next time the origin volume is activated. When merging starts, the resulting LV will have the origin's name, minor number and UUID. While the merge is in progress, reads or writes to the origin appear as being directed to the snapshot being merged. When the merge finishes, the merged snapshot is removed. Multiple snapshots may be specified on the command line or a @tag may be used to specify multiple snapshots be merged to their respective origin. Merge thin LV into its origin LV. The origin thin LV takes the content of the thin snapshot, and the thin snapshot LV is removed. See \fBlvmthin\fP(7) for more information. When the command is run with --config and/or --commandprofile (or using LVM_COMMAND_PROFILE environment variable), --profile, or --metadataprofile, merge all the contents of the "config cascade" before displaying it. Without merging, only the configuration at the front of the cascade is displayed. See \fBlvm.conf\fP(5) for more information about config. Specifies the metadataignore property of a PV. If yes, metadata areas on the PV are ignored, and lvm will not store metadata in the metadata areas of the PV. If no, lvm will store metadata on the PV. The metadata profile to use for command configuration. See \fBlvm.conf\fP(5) for more information about profiles. The approximate amount of space used for each VG metadata area. The size may be rounded. #lvcreate #lvchange Sets the minor number of an LV block device. #pvscan The minor number of a device. Sets the minimum recovery rate for a RAID LV. The rate value is an amount of data per second for each device in the array. Setting the rate to 0 means it will be unbounded. See \fBlvmraid\fP(7) for more information. Specifies the type of mirror log for LVs with the "mirror" type (does not apply to the "raid1" type.) \fBdisk\fP is a persistent log and requires a small amount of storage space, usually on a separate device from the data being mirrored. \fBcore\fP is not persistent; the log is kept only in memory. In this case, the mirror must be synchronized (by copying LV data from the first device to others) each time the LV is activated, e.g. after reboot. \fBmirrored\fP is a persistent log that is itself mirrored, but should be avoided. Instead, use the raid1 type for log redundancy. Only remove missing PVs from mirror LVs. Also checks the LVM special files in /dev that are needed for active LVs and creates any missing ones and removes unused ones. Start (yes) or stop (no) monitoring an LV with dmeventd. dmeventd monitors kernel events for an LV, and performs automated maintenance for the LV in reponse to specific events. See \fBdmeventd\fP(8) for more information. Add an "LVM2_" prefix plus the field name to the output. Useful with --noheadings to produce a list of field=value pairs that can be used to set environment variables (for example, in udev rules). Suppress the headings line that is normally the first line of output. Useful if grepping the output. Do not use the hints file to locate devices for PVs. A command may read more devices to find PVs when hints are not used. The command will still perform standard hint file invalidation where appropriate. Do not record history of LVs being removed. This has no effect unless the configuration setting metadata/record_lvs_history is enabled. In conjunction with --uuid, this allows a uuid to be specified without also requiring that a backup of the metadata be provided. Suppress the suffix on output sizes. Use with --units (except h and H) if processing the output. Causes the creation of mirror, raid1, raid4, raid5 and raid10 to skip the initial synchronization. In case of mirror, raid1 and raid10, any data written afterwards will be mirrored, but the original contents will not be copied. In case of raid4 and raid5, no parity blocks will be written, though any data written afterwards will cause parity blocks to be stored. This is useful for skipping a potentially long and resource intensive initial sync of an empty mirror/raid1/raid4/raid5 and raid10 LV. This option is not valid for raid6, because raid6 relies on proper parity (P and Q Syndromes) being created during initial synchronization in order to reconstruct proper user date in case of device failures. raid0 and raid0_meta do not provide any data copies or parity support and thus do not support initial synchronization. Send a notification to D-Bus. The command will exit with an error if LVM is not built with support for D-Bus notification, or if the notify_dbus config setting is disabled. Disables udev synchronisation. The process will not wait for notification from udev. It will continue irrespective of any possible udev processing in the background. Only use this if udev is not running or has rules that ignore the devices LVM creates. Specifies the name to use for the external origin LV when converting an LV to a thin LV. The LV being converted becomes a read-only external origin with this name. Overrides the automatically detected size of the PV. Use with care, or prior to reducing the physical size of the device. Specifies command specific settings in "Key = Value" form. Combine multiple settings in quotes, or repeat the settings option for each. When yes, start the background transformation of an LV. An incomplete transformation, e.g. pvmove or lvconvert interrupted by reboot or crash, can be restarted from the last checkpoint with --poll y. When no, background transformation of an LV will not occur, and the transformation will not complete. It may not be appropriate to immediately poll an LV after activation, in which case --poll n can be used to defer polling until a later --poll y command. The command to perform from lvmpolld. The name of a an LV to use for storing pool metadata. #lvcreate #lvconvert Specifies the size of the new pool metadata LV. #lvresize #lvextend Specifies the new size of the pool metadata LV. The plus prefix \fB+\fP can be used, in which case the value is added to the current size. Enable or disable the automatic creation and management of a spare pool metadata LV in the VG. A spare metadata LV is reserved space that can be used when repairing a pool. An alias for --commandprofile or --metadataprofile, depending on the command. The number of metadata areas to set aside on a PV for storing VG metadata. When 2, one copy of the VG metadata is stored at the front of the PV and a second copy is stored at the end. When 1, one copy of the VG metadata is stored at the front of the PV. When 0, no copies of the VG metadata are stored on the given PV. This may be useful in VGs containing many PVs (this places limitations on the ability to use vgsplit later.) Enable or disable data integrity checksums for raid images. The block size to use for dm-integrity on raid images. The integrity block size should usually match the device logical block size, or the file system block size. It may be less than the file system block size, but not less than the device logical block size. Possible values: 512, 1024, 2048, 4096. Use a journal (default) or bitmap for keeping integrity checksums consistent in case of a crash. The bitmap areas are recalculated after a crash, so corruption in those areas would not be detected. A journal does not have this problem. The journal mode doubles writes to storage, but can improve performance for scattered writes packed into a single journal write. bitmap mode can in theory achieve full write throughput of the device, but would not benefit from the potential scattered write optimization. Run the command in a special read-only mode which will read on-disk metadata without needing to take any locks. This can be used to peek inside metadata used by a virtual machine image while the virtual machine is running. No attempt will be made to communicate with the device-mapper kernel driver, so this option is unable to report whether or not LVs are actually in use. If the LV is active, reload its metadata. This is not necessary in normal operation, but may be useful if something has gone wrong, or if some form of manual LV sharing is being used. Removes all missing PVs from the VG, if there are no LVs allocated on them. This resumes normal operation of the VG (new LVs may again be created, changed and so on). If this is not possible because LVs are referencing the missing PVs, this option can be combined with --force to have the command remove any partial LVs. In this case, any LVs and dependent snapshots that were partly on the missing disks are removed completely, including those parts on disks that are still present. If LVs spanned several disks, including ones that are lost, salvaging some data first may be possible by activating LVs in partial mode. Selects a PV to rebuild in a raid LV. Multiple PVs can be rebuilt by repeating this option. Use this option in place of --resync or --syncaction repair when the PVs with corrupted data are known, and their data should be reconstructed rather than reconstructing default (rotating) data. See \fBlvmraid\fP(7) for more information. #lvconvert Replace failed PVs in a raid or mirror LV, or run a repair utility on a thin pool. See \fBlvmraid\fP(7) and \fBlvmthin\fP(7) for more information. #pvck Repair headers and metadata on a PV. Repair headers and metadata on a PV. See command description. Replace a specific PV in a raid LV with another PV. The new PV to use can be optionally specified after the LV. Multiple PVs can be replaced by repeating this option. See \fBlvmraid\fP(7) for more information. Overrides current output format for reports which is defined globally by the report/output_format setting in \fBlvm.conf\fP(5). \fBbasic\fP is the original format with columns and rows. If there is more than one report per command, each report is prefixed with the report name for identification. \fBjson\fP produces report output in JSON format. See \fBlvmreport\fP(7) for more information. In conjunction with --uuid, this reads the file (produced by vgcfgbackup), extracts the location and size of the data on the PV, and ensures that the metadata produced by the program is consistent with the contents of the file, i.e. the physical extents will be in the same place and not be overwritten by new metadata. This provides a mechanism to upgrade the metadata format or to add/remove metadata areas. Use with care. Add a PV back into a VG after the PV was missing and then returned, e.g. due to a transient failure. The PV is not reinitialized. Initiates mirror synchronization. Synchronization generally happens automatically, but this option forces it to run. Also see --rebuild to synchronize a specific PV. During synchronization, data is read from the primary mirror device and copied to the others. This can take considerable time, during which the LV is without a complete redundant copy of the data. See \fBlvmraid\fP(7) for more information. #pvs Produces one line of output for each contiguous allocation of space on each PV, showing the start (pvseg_start) and length (pvseg_size) in units of physical extents. #lvs Use default columns that emphasize segment information. String to use to separate each column. Useful if grepping the output. #vgcreate Create a shared VG using lvmlockd if LVM is compiled with lockd support. lvmlockd will select lock type sanlock or dlm depending on which lock manager is running. This allows multiple hosts to share a VG on shared devices. lvmlockd and a lock manager must be configured and running. See \fBlvmlockd\fP(8) for more information about shared VGs. #vgs #lvs #pvs #fullreport #vgdisplay #lvdisplay #pvdisplay Report/display shared VGs that would otherwise be skipped when lvmlockd is not being used on the host. See \fBlvmlockd\fP(8) for more information about shared VGs. Specify an LVM version in x.y.z format where x is the major version, the y is the minor version and z is the patchlevel (e.g. 2.2.106). This option is currently applicable only with --typeconfig new to display all configuration settings introduced since given version. Separates a cache pool from a cache LV, and keeps the unused cache pool LV. Before the separation, the cache is flushed. Also see --uncache. Splits the specified number of images from a raid1 or mirror LV and uses them to create a new LV. If --trackchanges is also specified, changes to the raid1 LV are tracked while the split LV remains detached. If --name is specified, then the images are permanently split from the original LV and changes are not tracked. Separates a COW snapshot from its origin LV. The LV that is split off contains the chunks that differ from the origin LV along with metadata describing them. This LV can be wiped and then destroyed with lvremove. Include deprecated configuration settings in the output. These settings are deprecated after a certain version. If a concrete version is specified with --atversion, deprecated settings are automatically included if the specified version is lower than the version in which the settings were deprecated. The current and diff types include deprecated settings in their output by default, all the other types ignore deprecated settings. Include unsupported configuration settings in the output. These settings are either used for debugging or development purposes only, or their support is not yet complete and they are not meant to be used in production. The current and diff types include unsupported settings in their output by default, all the other types ignore unsupported settings. Start polling an LV to continue processing a conversion. Specifies the number of stripes in a striped LV. This is the number of PVs (devices) that a striped LV is spread across. Data that appears sequential in the LV is spread across multiple devices in units of the stripe size (see --stripesize). This does not apply to existing allocated space, only newly allocated space can be striped. Extracts the metadata LV from a pool and replaces it with another specified LV. The extracted LV is preserved and given the name of the LV that replaced it. Use for repair only. When the metadata LV is swapped out of the pool, it can be activated directly and used with thin provisioning tools: \fBcache_dump\fP(8), \fBcache_repair\fP(8), \fBcache_restore\fP(8), \fBthin_dump\fP(8), \fBthin_repair\fP(8), \fBthin_restore\fP(8). Initiate different types of RAID synchronization. This causes the RAID LV to read all data and parity blocks in the array and check for discrepancies (mismatches between mirrors or incorrect parity values). \fBcheck\fP will count but not correct discrepancies. \fBrepair\fP will correct discrepancies. See \fBlvs\fP(8) for reporting discrepancies found or repaired. Indicates that vgchange/lvchange is being invoked from early system initialisation scripts (e.g. rc.sysinit or an initrd), before writable filesystems are available. As such, some functionality needs to be disabled and this option acts as a shortcut which selects an appropriate set of options. Currently, this is equivalent to using --ignorelockingfailure, --ignoremonitoring, --poll n, and setting env var LVM_SUPPRESS_LOCKING_FAILURE_MESSAGES. vgchange/lvchange skip autoactivation, and defer to pvscan autoactivation. #vgcreate Specifies the system ID that will be given to the new VG, overriding the system ID of the host running the command. A VG is normally created without this option, in which case the new VG is given the system ID of the host creating it. Using this option requires caution because the system ID of the new VG may not match the system ID of the host running the command, leaving the VG inaccessible to the host. See \fBlvmsystemid\fP(7) for more information. #vgchange Changes the system ID of the VG. Using this option requires caution because the VG may become foreign to the host running the command, leaving the host unable to access it. See \fBlvmsystemid\fP(7) for more information. Can be used with --splitmirrors on a raid1 LV. This causes changes to the original raid1 LV to be tracked while the split images remain detached. This is a temporary state that allows the read-only detached image to be merged efficiently back into the raid1 LV later. Only the regions with changed data are resynchronized during merge. While a raid1 LV is tracking changes, operations on it are limited to merging the split image (see --mergemirrors) or permanently splitting the image (see --splitmirrors with --name. The LV type, also known as "segment type" or "segtype". See usage descriptions for the specific ways to use these types. For more information about redundancy and performance (\fBraid\fP, \fBmirror\fP, \fBstriped\fP, \fBlinear\fP) see \fBlvmraid\fP(7). For thin provisioning (\fBthin\fP, \fBthin-pool\fP) see \fBlvmthin\fP(7). For performance caching (\fBcache\fP, \fBcache-pool\fP) see \fBlvmcache\fP(7). For copy-on-write snapshots (\fBsnapshot\fP) see usage definitions. For VDO (\fBvdo\fP) see \fBlvmvdo\fP(7). Several commands omit an explicit type option because the type is inferred from other options or shortcuts (e.g. --stripes, --mirrors, --snapshot, --virtualsize, --thin, --cache, --vdo). Use inferred types with care because it can lead to unexpected results. Command output is modified to be imported from a udev rule. Produce output immediately without sorting or aligning the columns properly. Separates a cache pool from a cache LV, and deletes the unused cache pool LV. Before the separation, the cache is flushed. Also see --splitcache. Update the content of the devices file. Specifies the cache policy for a cache LV. See \fBlvmcache\fP(7) for more information. Specifies tunable values for a cache LV in "Key = Value" form. Repeat this option to specify multiple values. (The default values should usually be adequate.) The special string value \fBdefault\fP switches settings back to their default kernel values and removes them from the list of settings stored in LVM metadata. See \fBlvmcache\fP(7) for more information. Internal option used for generating config file during build. All sizes are output in these units: human-(r)eadable with '<' rounding indicator, (h)uman-readable, (b)ytes, (s)ectors, (k)ilobytes, (m)egabytes, (g)igabytes, (t)erabytes, (p)etabytes, (e)xabytes. Capitalise to use multiples of 1000 (S.I.) instead of 1024. Custom units can be specified, e.g. --units 3M. When used with --nameprefixes, output values in the field=value pairs are not quoted. Perform an operation according to the policy configured in \fBlvm.conf\fP(5) or a profile. Validate current configuration used and exit with appropriate return code. The validation is done only for the configuration at the front of the "config cascade". To validate the whole merged configuration tree, also use --mergedconfig. The validation is done even if \fBlvm.conf\fP(5) \fBconfig/checks\fP is disabled. Specifies the command is handling VDO LV. See --type vdo. See \fBlvmvdo\fP(7) for more information about VDO usage. The name of a VDO pool LV. See \fBlvmvdo\fP(7) for more information about VDO usage. Specifies tunable VDO options for VDO LVs. Use the form 'option=value' or 'option1=value option2=value', or repeat --vdosettings for each option being set. These settings override the default VDO behaviors. To remove vdosettings and revert to the default VDO behaviors, use --vdosettings 'default'. See \fBlvmvdo\fP(7) for more information. Number of copies of the VG metadata that are kept. VG metadata is kept in VG metadata areas on PVs in the VG, i.e. reserved space at the start and/or end of the PVs. Keeping a copy of the VG metadata on every PV can reduce performance in VGs containing a large number of PVs. When this number is set to a non-zero value, LVM will automatically choose PVs on which to store metadata, using the metadataignore flags on PVs to achieve the specified number. The number can also be replaced with special string values: \fBunmanaged\fP causes LVM to not automatically manage the PV metadataignore flags. \fBall\fP causes LVM to first clear the metadataignore flags on all PVs, and then to become unmanaged. The first command to see a complete VG will report it uniquely. Other commands to see the complete VG will report it differently. Display a one line comment for each configuration node. Display a full comment for each configuration node. For deprecated settings, also display comments about deprecation. Include general config file preamble. Include local config file preamble. Where appropriate, add more spaces in output for better readability. Also display a comment containing the version of introduction for each configuration node. If the setting is deprecated, also display the version since which it is deprecated. The maximum number of outstanding writes that are allowed to devices in a RAID1 LV that is marked write-mostly. Once this value is exceeded, writes become synchronous (i.e. all writes to the constituent devices must complete before the array signals the write has completed). Setting the value to zero clears the preference and allows the system to choose the value arbitrarily. Mark a device in a RAID1 LV as write-mostly. All reads to these drives will be avoided unless absolutely necessary. This keeps the number of I/Os to the drive to a minimum. The default behavior is to set the write-mostly attribute for the specified PV. It is also possible to remove the write-mostly flag by adding the suffix \fB:n\fP at the end of the PV name, or to toggle the value with the suffix \fB:t\fP. Repeat this option to change the attribute on multiple PVs. #pvscan Auto-activate LVs in a VG when the PVs scanned have completed the VG. (Only \fBay\fP is applicable.) #lvchange #vgchange Change the active state of LVs. An active LV can be used through a block device, allowing data on the LV to be accessed. \fBy\fP makes LVs active, or available. \fBn\fP makes LVs inactive, or unavailable. The block device for the LV is added or removed from the system using device-mapper in the kernel. A symbolic link /dev/VGName/LVName pointing to the device node is also added/removed. All software and scripts should access the device through the symbolic link and present this as the name of the device. The location and name of the underlying device node may depend on the distribution, configuration (e.g. udev), or release version. \fBay\fP specifies autoactivation, which is used by system-generated activation commands. By default, LVs are autoactivated. An autoactivation property can be set on a VG or LV to disable autoactivation, see --setautoactivation y|n in vgchange, lvchange, vgcreate, and lvcreate. Display the property with vgs or lvs "-o autoactivation". The \fBlvm.conf\fP(5) auto_activation_volume_list includes names of VGs or LVs that should be autoactivated, and anything not listed is not autoactivated. When auto_activation_volume_list is undefined (the default), it has no effect. If auto_activation_volume_list is defined and empty, no LVs are autoactivated. Items included by auto_activation_volume_list will not be autoactivated if the autoactivation property has been disabled. See \fBlvmlockd\fP(8) for more information about activation options \fBey\fP and \fBsy\fP for shared VGs. #lvcreate Controls the active state of the new LV. \fBy\fP makes the LV active, or available. New LVs are made active by default. \fBn\fP makes the LV inactive, or unavailable, only when possible. In some cases, creating an LV requires it to be active. For example, COW snapshots of an active origin LV can only be created in the active state (this does not apply to thin snapshots). The --zero option normally requires the LV to be active. If autoactivation \fBay\fP is used, the LV is only activated if it matches an item in \fBlvm.conf\fP(5) \fBactivation/auto_activation_volume_list\fP. \fBay\fP implies --zero n and --wipesignatures n. See \fBlvmlockd\fP(8) for more information about activation options for shared VGs. #vgreduce Removes all empty PVs if none are named on the command line. #pvchange Change all visible PVs. #vgimport Import all visible VGs. #lvscan #lvdisplay #lvs Show information about internal LVs. These are components of normal LVs, such as mirrors, which are not independently accessible, e.g. not mountable. #vgs List all VGs. Equivalent to not specifying any VGs. #pvs #pvdisplay Show information about devices that have not been initialized by LVM, i.e. they are not PVs. Specifies if metadata should be backed up automatically after a change. Enabling this is strongly advised! See \fBvgcfgbackup\fP(8) for more information. Only select active VGs. The VG is considered active if at least one of its LVs is active. If the operation requires polling, this option causes the command to return before the operation is complete, and polling is done in the background. By default the snapshot VG will be renamed to the original name plus a numeric suffix to avoid duplicate naming (e.g. 'test_vg' would be renamed to 'test_vg1'). This option will override the base VG name that is used for all VG renames. If a VG already exists with the specified name a numeric suffix will be added (like the previous example) to make it unique. The size of chunks in a snapshot, cache pool or thin pool. For snapshots, the value must be a power of 2 between 4KiB and 512KiB and the default value is 4. For a cache pool the value must be between 32KiB and 1GiB and the default value is 64. For a thin pool the value must be between 64KiB and 1GiB and the default value starts with 64 and scales up to fit the pool metadata size within 128MiB, if the pool metadata size is not specified. The value must be a multiple of 64KiB. See \fBlvmthin\fP(7) and \fBlvmcache\fP(7) for more information. This option was specific to clvm and is now replaced by the --shared option with \fBlvmlockd\fP(8). Generate colon separated output for easier parsing in scripts or programs. Also see \fBvgs\fP(8) which provides considerably more control over the output. Display output in columns, the equivalent of \fBvgs\fP(8). Options listed are the same as options given in \fBvgs\fP(8). Sets or resets the contiguous allocation policy for LVs. Default is no contiguous allocation based on a next free principle. It is only possible to change a non-contiguous allocation policy to contiguous if all of the allocated physical extents in the LV are already contiguous. Set debug level. Repeat from 1 to 6 times to increase the detail of messages sent to the log file and/or syslog (if configured). Only show PVs belonging to exported VGs. #pvck Metadata file to read or write. #lvmconfig #dumpconfig #config Write output to the named file. #vgcfgbackup Write the backup to the named file. When backing up more than one VG, the file name is treated as a template, and %s is replaced by the VG name. #vgcfgrestore Read metadata backup from the named file. Usually this file was created by vgcfgbackup. Override various checks, confirmations and protections. Use with extreme caution. Specifies the command is handling a cache LV or cache pool. See --type cache and --type cache-pool. See \fBlvmcache\fP(7) for more information about LVM caching. Include historical LVs in the output. (This has no effect unless LVs were removed while \fBlvm.conf\fP(5) \fBmetadata/record_lvs_history\fP was enabled. Import exported VGs. Otherwise VGs that have been exported will not be changed (nor will their associated PVs). Report progress at regular intervals. Specifies the number of stripes in a striped LV. This is the number of PVs (devices) that a striped LV is spread across. Data that appears sequential in the LV is spread across multiple devices in units of the stripe size (see --stripesize). This does not change existing allocated space, but only applies to space being allocated by the command. When creating a RAID 4/5/6 LV, this number does not include the extra devices that are required for parity. The largest number depends on the RAID type (raid0: 64, raid10: 32, raid4/5: 63, raid6: 62), and when unspecified, the default depends on the RAID type (raid0: 2, raid10: 2, raid4/5: 3, raid6: 5.) To stripe a new raid LV across all PVs by default, see \fBlvm.conf\fP(5) \fBallocation/raid_stripe_all_devices\fP. The amount of data that is written to one device before moving to the next in a striped LV. Sets the maximum number of LVs allowed in a VG. #lvcreate Specifies the size of the new LV in logical extents. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. An alternate syntax allows the size to be determined indirectly as a percentage of the size of a related VG, LV, or set of PVs. The suffix \fB%VG\fP denotes the total size of the VG, the suffix \fB%FREE\fP the remaining free space in the VG, and the suffix \fB%PVS\fP the free space in the specified PVs. For a snapshot, the size can be expressed as a percentage of the total size of the origin LV with the suffix \fB%ORIGIN\fP (\fB100%ORIGIN\fP provides space for the whole origin). When expressed as a percentage, the size defines an upper limit for the number of logical extents in the new LV. The precise number of logical extents in the new LV is not determined until the command has completed. #lvreduce #lvextend #lvresize Specifies the new size of the LV in logical extents. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. An alternate syntax allows the size to be determined indirectly as a percentage of the size of a related VG, LV, or set of PVs. The suffix \fB%VG\fP denotes the total size of the VG, the suffix \fB%FREE\fP the remaining free space in the VG, and the suffix \fB%PVS\fP the free space in the specified PVs. For a snapshot, the size can be expressed as a percentage of the total size of the origin LV with the suffix \fB%ORIGIN\fP (\fB100%ORIGIN\fP provides space for the whole origin). When expressed as a percentage, the size defines an upper limit for the number of logical extents in the new LV. The precise number of logical extents in the new LV is not determined until the command has completed. When the plus \fB+\fP or minus \fB-\fP prefix is used, the value is not an absolute size, but is relative and added or subtracted from the current size. #lvmconfig #dumpconfig #config List config settings with summarizing comment. This is the same as using options --typeconfig list --withsummary. #vgcfgrestore List metadata backup and archive files pertaining to the VG. May be used with --file. Does not restore the VG. #vgmerge Display merged destination VG like vgdisplay -v. #lvcreate Specifies the size of the new LV. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. #lvreduce #lvextend #lvresize Specifies the new size of the LV. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. When the plus \fB+\fP or minus \fB-\fP prefix is used, the value is not an absolute size, but is relative and added or subtracted from the current size. When yes, makes the specified minor number persistent. #lvcreate #lvchange Sets the major number of an LV block device. #pvscan The major number of a device. Persistently sets (yes) or clears (no) the "activation skip" flag on an LV. An LV with this flag set is not activated unless the --ignoreactivationskip option is used by the activation command. This flag is set by default on new thin snapshot LVs. The flag is not applied to deactivation. The current value of the flag is indicated in the lvs lv_attr bits. Ignore the "activation skip" LV flag during activation to allow LVs with the flag set to be activated. #lvdisplay Display the mapping of logical extents to PVs and physical extents. To map physical extents to logical extents use: pvs --segments -o+lv_name,seg_start_pe,segtype #pvdisplay Display the mapping of physical extents to LVs and logical extents. #lvcreate Specifies the number of mirror images in addition to the original LV image, e.g. --mirrors 1 means there are two images of the data, the original and one mirror image. Optional positional PV args on the command line can specify the devices the images should be placed on. There are two mirroring implementations: "raid1" and "mirror". These are the names of the corresponding LV types, or "segment types". Use the --type option to specify which to use (raid1 is default, and mirror is legacy) Use \fBlvm.conf\fP(5) \fBglobal/mirror_segtype_default\fP and global/raid10_segtype_default to configure the default types. See the --nosync option for avoiding initial image synchronization. See \fBlvmraid\fP(7) for more information. #lvconvert Specifies the number of mirror images in addition to the original LV image, e.g. --mirrors 1 means there are two images of the data, the original and one mirror image. Optional positional PV args on the command line can specify the devices the images should be placed on. There are two mirroring implementations: "raid1" and "mirror". These are the names of the corresponding LV types, or "segment types". Use the --type option to specify which to use (raid1 is default, and mirror is legacy) Use \fBlvm.conf\fP(5) \fBglobal/mirror_segtype_default\fP and global/raid10_segtype_default to configure the default types. The plus prefix \fB+\fP can be used, in which case the number is added to the current number of images, or the minus prefix \fB-\fP can be used, in which case the number is subtracted from the current number of images. See \fBlvmraid\fP(7) for more information. #lvextend Not used. Specifies the type of on-disk metadata to use. \fBlvm2\fP (or just \fB2\fP) is the current, standard format. \fBlvm1\fP (or just \fB1\fP) is no longer used. #lvcreate #lvconvert Specifies the name of a new LV. When unspecified, a default name of "lvol#" is generated, where # is a number generated by LVM. #pvmove Move only the extents belonging to the named LV. #vgsplit Move only PVs used by the named LV. Do not perform fsck before resizing filesystem when filesystem requires it. You may need to use --force to proceed with this option. Only show PVs not belonging to any VG. Comma-separated, ordered list of fields to display in columns. String arg syntax is: [\fB+\fP|\fB-\fP|\fB#\fP]\fIField1\fP[\fB,\fP\fIField2\fP ...] The prefix \fB+\fP will append the specified fields to the default fields, \fB-\fP will remove the specified fields from the default fields, and \fB#\fP will compact specified fields (removing them when empty for all rows.) Use \fB-o help\fP to view the list of all available fields. Use separate lists of fields to add, remove or compact by repeating the -o option: -o+field1,field2 -o-field3,field4 -o#field5. These lists are evaluated from left to right. Use field name \fBlv_all\fP to view all LV fields, \fBvg_all\fP all VG fields, \fBpv_all\fP all PV fields, \fBpvseg_all\fP all PV segment fields, \fBseg_all\fP all LV segment fields, and \fBpvseg_all\fP all PV segment columns. See the \fBlvm.conf\fP(5) report section for more config options. See \fBlvmreport\fP(7) for more information about reporting. Comma-separated ordered list of columns to sort by. Replaces the default selection. Precede any column with \fB-\fP for a reverse sort on that column. Sets the maximum number of PVs that can belong to the VG. The value 0 removes any limitation. For large numbers of PVs, also see options --pvmetadatacopies, and --vgmetadatacopies for improving performance. Set access permission to read only \fBr\fP or read and write \fBrw\fP. Commands will do their best to activate LVs with missing PV extents. Missing extents may be replaced with error or zero segments according to the missing_stripe_filler setting. Metadata may not be changed with this option. Suppress output and log messages. Overrides --debug and --verbose. Repeat once to also suppress any prompts with answer 'no'. Sets read ahead sector count of an LV. \fBauto\fP is the default which allows the kernel to choose a suitable value automatically. \fBnone\fP is equivalent to zero. Resize underlying filesystem together with the LV using \fBfsadm\fP(8). Size of each raid or mirror synchronization region. \fBlvm.conf\fP(5) \fBactivation/raid_region_size\fP can be used to configure a default. #vgcreate Sets the physical extent size of PVs in the VG. The value must be either a power of 2 of at least 1 sector (where the sector size is the largest sector size of the PVs currently used in the VG), or at least 128KiB. Once this value has been set, it is difficult to change without recreating the VG, unless no extents need moving. #vgchange Sets the physical extent size of PVs in the VG. The value must be either a power of 2 of at least 1 sector (where the sector size is the largest sector size of the PVs currently used in the VG), or at least 128KiB. Once this value has been set, it is difficult to change without recreating the VG, unless no extents need moving. Before increasing the physical extent size, you might need to use lvresize, pvresize and/or pvmove so that everything fits. For example, every contiguous range of extents used in a LV must start and end on an extent boundary. #lvcreate Create a snapshot. Snapshots provide a "frozen image" of an origin LV. The snapshot LV can be used, e.g. for backups, while the origin LV continues to be used. This option can create a COW (copy on write) snapshot, or a thin snapshot (in a thin pool.) Thin snapshots are created when the origin is a thin LV and the size option is NOT specified. Thin snapshots share the same blocks in the thin pool, and do not allocate new space from the VG. Thin snapshots are created with the "activation skip" flag, see --setactivationskip. A thin snapshot of a non-thin "external origin" LV is created when a thin pool is specified. Unprovisioned blocks in the thin snapshot LV are read from the external origin LV. The external origin LV must be read-only. See \fBlvmthin\fP(7) for more information about LVM thin provisioning. COW snapshots are created when a size is specified. The size is allocated from space in the VG, and is the amount of space that can be used for saving COW blocks as writes occur to the origin or snapshot. The size chosen should depend upon the amount of writes that are expected; often 20% of the origin LV is enough. If COW space runs low, it can be extended with lvextend (shrinking is also allowed with lvreduce.) A small amount of the COW snapshot LV size is used to track COW block locations, so the full size is not available for COW data blocks. Use lvs to check how much space is used, and see --monitor to to automatically extend the size to avoid running out of space. #lvconvert Combine a former COW snapshot LV with a former origin LV to reverse a previous --splitsnapshot command. #pvdisplay Only display the size of the given PVs. #vgdisplay Give a short listing showing the existence of VGs. #pvscan Short listing format. Select objects for processing and reporting based on specified criteria. The criteria syntax is described by \fB--select help\fP and \fBlvmreport\fP(7). For reporting commands, one row is displayed for each object matching the criteria. See \fB--options help\fP for selectable object fields. Rows can be displayed with an additional "selected" field (-o selected) showing 1 if the row matches the selection and 0 otherwise. For non-reporting commands which process LVM entities, the selection is used to choose items to process. Run in test mode. Commands will not update metadata. This is implemented by disabling all metadata writing but nevertheless returning success to the calling function. This may lead to unusual error messages in multi-stage operations if a tool relies on reading back metadata it believes has changed but hasn't. Specifies the command is handling a thin LV or thin pool. See --type thin, --type thin-pool, and --virtualsize. See \fBlvmthin\fP(7) for more information about LVM thin provisioning. Update VG metadata to correct problems. If VG metadata was updated while a PV was missing, and the PV reappears with an old version of metadata, then this option (or any other command that writes metadata) will update the metadata on the previously missing PV. If a PV was removed from a VG while it was missing, and the PV reappears, using this option will clear the outdated metadata from the previously missing PV. If metadata text is damaged on one PV, using this option will replace the damaged metadata text. For more severe damage, e.g. with headers, see \fBpvck\fP(8). #pvchange Generate new random UUID for specified PVs. #pvscan Show UUIDs in addition to device names. #vgchange Generate new random UUID for specified VGs. Specify a UUID for the device. Without this option, a random UUID is generated. This option is needed before restoring a backup of LVM metadata onto a replacement device; see \fBvgcfgrestore\fP(8). As such, use of --restorefile is compulsory unless the --norestorefile is used. All PVs must have unique UUIDs, and LVM will prevent certain operations if multiple devices are seen with the same UUID. See \fBvgimportclone\fP(8) for more information. Set verbose level. Repeat from 1 to 4 times to increase the detail of messages sent to stdout and stderr. The virtual size of a new thin LV. See \fBlvmthin\fP(7) for more information about LVM thin provisioning. Using virtual size (-V) and actual size (-L) together creates a sparse LV. \fBlvm.conf\fP(5) \fBglobal/sparse_segtype_default\fP determines the default segment type used to create a sparse LV. Anything written to a sparse LV will be returned when reading from it. Reading from other areas of the LV will return blocks of zeros. When using a snapshot to create a sparse LV, a hidden virtual device is created using the zero target, and the LV has the suffix _vorigin. Snapshots are less efficient than thin provisioning when creating large sparse LVs (GiB). Controls detection and subsequent wiping of signatures on new LVs. There is a prompt for each signature detected to confirm its wiping (unless --yes is used to override confirmations.) When not specified, signatures are wiped whenever zeroing is done (see --zero). This behaviour can be configured with \fBlvm.conf\fP(5) \fBallocation/wipe_signatures_when_zeroing_new_lvs\fP. If blkid wiping is used (\fBlvm.conf\fP(5) \fBallocation/use_blkid_wiping\fP) and LVM is compiled with blkid wiping support, then the blkid(8) library is used to detect the signatures (use blkid -k to list the signatures that are recognized). Otherwise, native LVM code is used to detect signatures (only MD RAID, swap and LUKS signatures are detected in this case.) The LV is not wiped if the read only flag is set. Enable or disable allocation of physical extents on this PV. Enables or disables the addition or removal of PVs to/from a VG (by vgextend/vgreduce). Do not prompt for confirmation interactively but always assume the answer yes. Use with extreme caution. (For automatic no, see -qq.) #lvchange Set zeroing mode for thin pool. Note: already provisioned blocks from pool in non-zero mode are not cleared in unwritten parts when setting --zero y. #lvconvert For snapshots, this controls zeroing of the first 4KiB of data in the snapshot. If the LV is read-only, the snapshot will not be zeroed. For thin pools, this controls zeroing of provisioned blocks. Provisioning of large zeroed chunks negatively impacts performance. #lvcreate Controls zeroing of the first 4KiB of data in the new LV. Default is \fBy\fP. Snapshot COW volumes are always zeroed. For thin pools, this controls zeroing of provisioned blocks. LV is not zeroed if the read only flag is set. Warning: trying to mount an unzeroed LV can cause the system to hang. #pvcreate #vgcreate #vgextend Controls if the first 4 sectors (2048 bytes) of the device are wiped. The default is to wipe these sectors unless either or both of --restorefile or --uuid are specified. writethrough|writeback|passthrough[Number]r|R|h|H|b|B|s|S|k|K|m|M|g|G|t|T|p|P|e|Elinear|striped|snapshot|raid|mirror|thin|thin-pool|vdo|vdo-pool|cache|cache-pool|writecachecontiguous|cling|cling_by_tags|normal|anywhere|inheritpvmove|convert|merge|merge_thincurrent|default|diff|full|list|missing|new|profilable|profilable-command|profilable-metadatapv_header|metadata|label_headerheaders|metadata|metadata_all|metadata_searchppppp@p0OO_ALL: --commandprofile String, --config String, --debug, --driverloaded Bool, --help, --nolocking, --lockopt String, --longhelp, --profile String, --quiet, --verbose, --version, --yes, --test, --devicesfile String, --devices PV, --nohints --journal String OO_REPORT: --aligned, --all, --binary, --configreport ConfigReport, --foreign, --ignorelockingfailure, --logonly, --nameprefixes, --noheadings, --nosuffix, --options String, --readonly, --reportformat ReportFmt, --rows, --select String, --separator String, --shared, --sort String, --unbuffered, --units Units, --unquoted OO_CONFIG: --atversion String, --typeconfig ConfigType, --file String, --ignoreadvanced, --ignoreunsupported, --ignorelocal, --list, --mergedconfig, --metadataprofile String, --sinceversion String, --showdeprecated, --showunsupported, --validate, --withsummary, --withcomments, --withgeneralpreamble, --withlocalpreamble, --withspaces, --unconfigured, --withversions OO_LVCHANGE: --autobackup Bool, --force, --ignoremonitoring, --noudevsync, --reportformat ReportFmt, --select String OO_LVCHANGE_META: --addtag Tag, --deltag Tag, --alloc Alloc, --contiguous Bool, --compression Bool, --deduplication Bool, --detachprofile, --metadataprofile String, --profile String, --permission Permission, --readahead Readahead, --setactivationskip Bool, --setautoactivation Bool, --errorwhenfull Bool, --discards Discards, --zero Bool, --cachemode CacheMode, --cachepolicy String, --cachesettings String, --minrecoveryrate SizeKB, --maxrecoveryrate SizeKB, --vdosettings String, --writebehind Number, --writemostly WriteMostlyPV, --persistent n lvchange OO_LVCHANGE_META VG|LV|Tag|Select ... OO: --activate Active, --poll Bool, --monitor Bool, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_properties DESC: Change a general LV attribute. DESC: For options listed in parentheses, any one is DESC: required, after which the others are optional. RULE: all not lv_is_pvmove lv_is_mirror_log lv_is_mirror_image RULE: all and lv_is_vg_writable RULE: --contiguous not --alloc RULE: --profile not --detachprofile RULE: --metadataprofile not --detachprofile RULE: --minrecoveryrate --maxrecoveryrate and LV_raid RULE: --writebehind --writemostly and LV_raid1 RULE: --cachemode --cachepolicy --cachesettings and LV_cache LV_cachepool LV_writecache RULE: --errorwhenfull --discards --zero and LV_thinpool RULE: --permission not lv_is_external_origin lv_is_raid_metadata lv_is_raid_image LV_thinpool RULE: --alloc --contiguous --metadataprofile --persistent --profile --readahead not lv_is_thick_origin RULE: --alloc --discards --zero --cachemode --cachepolicy --cachesettings not lv_is_partial lvchange --resync VG|LV_raid_mirror|Tag|Select ... OO: --activate Active, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_resync DESC: Resyncronize a mirror or raid LV. DESC: Use to reset 'R' attribute on a not initially synchronized LV. RULE: all not lv_is_pvmove lv_is_locked lv_is_raid_with_integrity RULE: all not LV_raid0 lvchange --syncaction SyncAction VG|LV_raid|Tag|Select ... OO: OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_syncaction DESC: Resynchronize or check a raid LV. RULE: all not LV_raid0 lvchange --rebuild PV VG|LV_raid|Tag|Select ... OO: OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_rebuild DESC: Reconstruct data on specific PVs of a raid LV. RULE: all not LV_raid0 lvchange --activate Active VG|LV|Tag|Select ... OO: --activationmode ActivationMode, --partial, --poll Bool, --monitor Bool, --ignoreactivationskip, --ignorelockingfailure, --sysinit, --readonly, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_activate DESC: Activate or deactivate an LV. lvchange --refresh VG|LV|Tag|Select ... OO: --activationmode ActivationMode, --partial, --poll Bool, --monitor Bool, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_refresh DESC: Reactivate an LV using the latest metadata. lvchange --monitor Bool VG|LV|Tag|Select ... OO: OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_monitor DESC: Start or stop monitoring an LV from dmeventd. RULE: all not lv_is_pvmove lvchange --poll Bool VG|LV|Tag|Select ... OO: --monitor Bool, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_poll DESC: Start or stop processing an LV conversion. lvchange --persistent y --minor Number LV OO: --major Number, --activate Active, --poll Bool, --monitor Bool, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_persistent DESC: Make the minor device number persistent for an LV. RULE: all not LV_thinpool LV_cachepool LV_vdopool OO_LVCONVERT_POOL: --poolmetadata LV, --poolmetadatasize SizeMB, --poolmetadataspare Bool, --readahead Readahead, --chunksize SizeKB, --zero Bool, --metadataprofile String OO_LVCONVERT_THINPOOL: --discards Discards, --errorwhenfull Bool OO_LVCONVERT_CACHE: --cachemetadataformat CacheMetadataFormat, --cachemode CacheMode, --cachepolicy String, --cachesettings String, --zero Bool OO_LVCONVERT_VDO: --metadataprofile String, --readahead Readahead, --compression Bool, --deduplication Bool, --vdosettings String, --zero Bool OO_LVCONVERT: --alloc Alloc, --background, --force, --noudevsync lvconvert --type linear LV OO: OO_LVCONVERT OP: PV ... ID: lvconvert_raid_types DESC: Convert LV to linear. RULE: all not lv_is_locked lv_is_pvmove lvconvert --type striped LV OO: --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, OO_LVCONVERT OP: PV ... ID: lvconvert_raid_types DESC: Convert LV to striped. RULE: all not lv_is_locked lv_is_pvmove lvconvert --type mirror LV OO: --mirrors SNumber, --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, --mirrorlog MirrorLog, OO_LVCONVERT OP: PV ... ID: lvconvert_raid_types DESC: Convert LV to type mirror (also see type raid1), RULE: all not lv_is_locked lv_is_pvmove lvconvert --type raid LV OO: --mirrors SNumber, --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, OO_LVCONVERT OP: PV ... ID: lvconvert_raid_types DESC: Convert LV to raid or change raid layout DESC: (a specific raid level must be used, e.g. raid1). RULE: all not lv_is_locked lv_is_pvmove RULE: lv_is_raid_with_integrity not --stripes_long --stripesize --regionsize --interval lvconvert --mirrors SNumber LV OO: --regionsize RegionSize, --interval Number, --mirrorlog MirrorLog, OO_LVCONVERT OP: PV ... ID: lvconvert_raid_types DESC: Convert LV to raid1 or mirror, or change number of mirror images. RULE: all not lv_is_locked lv_is_pvmove lvconvert --stripes_long Number LV_raid OO: OO_LVCONVERT, --interval Number, --regionsize RegionSize, --stripesize SizeKB OP: PV ... ID: lvconvert_raid_types DESC: Convert raid LV to change number of stripe images. RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrity RULE: all not LV_raid0 LV_raid1 lvconvert --stripesize SizeKB LV_raid OO: OO_LVCONVERT, --interval Number, --regionsize RegionSize ID: lvconvert_raid_types DESC: Convert raid LV to change the stripe size. RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrity RULE: all not LV_raid0 LV_raid1 lvconvert --regionsize RegionSize LV_raid OO: OO_LVCONVERT ID: lvconvert_change_region_size DESC: Change the region size of an LV. RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrity RULE: all not LV_raid0 FLAGS: SECONDARY_SYNTAX lvconvert --splitmirrors Number --name LV_new LV_raid1_mirror_cache OO: OO_LVCONVERT OP: PV ... ID: lvconvert_split_mirror_images DESC: Split images from a raid1 or mirror LV and use them to create a new LV. RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrity lvconvert --splitmirrors Number --trackchanges LV_raid1_cache OO: OO_LVCONVERT OP: PV ... ID: lvconvert_split_mirror_images DESC: Split images from a raid1 LV and track changes to origin for later merge. RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrity lvconvert --mergemirrors LV_linear_raid|VG|Tag ... OO: OO_LVCONVERT ID: lvconvert_merge_mirror_images DESC: Merge LV images that were split from a raid1 LV. RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cow lv_is_raid_with_integrity lvconvert --mirrorlog MirrorLog LV_mirror OO: OO_LVCONVERT OP: PV ... ID: lvconvert_change_mirrorlog DESC: Change the type of mirror log used by a mirror LV. RULE: all not lv_is_locked lv_is_pvmove FLAGS: SECONDARY_SYNTAX lvconvert --type thin --thinpool LV LV_linear_striped_raid_cache_thin_error_zero OO: --thin, --originname LV_new, OO_LVCONVERT_POOL, OO_LVCONVERT ID: lvconvert_to_thin_with_external DESC: Convert LV to a thin LV, using the original LV as an external origin. RULE: all and lv_is_visible RULE: all not lv_is_locked lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long lvconvert --thin --thinpool LV LV_linear_striped_raid_cache_thin_error_zero OO: --originname LV_new, OO_LVCONVERT_POOL, OO_LVCONVERT ID: lvconvert_to_thin_with_external DESC: Convert LV to a thin LV, using the original LV as an external origin. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin RULE: all and lv_is_visible RULE: all not lv_is_locked lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long lvconvert --type cache --cachepool LV LV_linear_striped_raid_thinpool_vdo_vdopool_vdopooldata OO: --cache, OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERT ID: lvconvert_to_cache_with_cachepool DESC: Attach a cache pool to an LV, converts the LV to type cache. RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long lvconvert --cache --cachepool LV LV_linear_striped_raid_thinpool_vdo_vdopool_vdopooldata OO: OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERT ID: lvconvert_to_cache_with_cachepool DESC: Attach a cache pool to an LV. RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long FLAGS: SECONDARY_SYNTAX AUTOTYPE: cache lvconvert --type writecache --cachevol LV LV_linear_striped_raid_thinpool OO: OO_LVCONVERT, --cachesettings String ID: lvconvert_to_writecache DESC: Attach a writecache to an LV, converts the LV to type writecache. RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity lvconvert --type cache --cachevol LV LV_linear_striped_raid_thinpool OO: --cache, OO_LVCONVERT_CACHE, OO_LVCONVERT, --poolmetadatasize SizeMB, --chunksize SizeKB ID: lvconvert_to_cache_with_cachevol DESC: Attach a cache to an LV, converts the LV to type cache. RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity lvconvert --cache --cachevol LV LV_linear_striped_raid_thinpool OO: OO_LVCONVERT_CACHE, OO_LVCONVERT, --poolmetadatasize SizeMB, --chunksize SizeKB ID: lvconvert_to_cache_with_cachevol DESC: Attach a cache to an LV, converts the LV to type cache. RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity FLAGS: SECONDARY_SYNTAX lvconvert --type writecache --cachedevice PV LV_linear_striped_raid_thinpool OO: OO_LVCONVERT, --cachesize SizeMB, --cachesettings String ID: lvconvert_to_writecache_with_device DESC: Add a writecache to an LV, using a specified cache device. RULE: all and lv_is_visible lvconvert --type cache --cachedevice PV LV_linear_striped_raid_thinpool OO: OO_LVCONVERT, --cachesize SizeMB, --cachesettings String, --chunksize SizeKB ID: lvconvert_to_cache_with_device DESC: Add a cache to an LV, using a specified cache device. RULE: all and lv_is_visible lvconvert --type thin-pool LV_linear_striped_raid_cache_writecache_error_zero OO: --stripes_long Number, --stripesize SizeKB, OO_LVCONVERT_THINPOOL, OO_LVCONVERT_POOL, OO_LVCONVERT OP: PV ... ID: lvconvert_to_thinpool DESC: Convert LV to type thin-pool. RULE: all and lv_is_visible RULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_virtual lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long lvconvert --thinpool LV_linear_striped_raid_cache_writecache_thinpool OO: --stripes_long Number, --stripesize SizeKB, OO_LVCONVERT_THINPOOL, OO_LVCONVERT_POOL, OO_LVCONVERT OP: PV ... ID: lvconvert_to_thinpool_or_swap_metadata DESC: Convert LV to type thin-pool (variant, use --type thin-pool). DESC: Swap metadata LV in a thin pool (variant, use --swapmetadata). FLAGS: PREVIOUS_SYNTAX RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long AUTOTYPE: thin-pool lvconvert --type cache-pool LV_linear_striped_raid OO: OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERT OP: PV ... ID: lvconvert_to_cachepool DESC: Convert LV to type cache-pool. RULE: --poolmetadata not --readahead --stripesize --stripes_long RULE: all not lv_is_raid_with_integrity lvconvert --cachepool LV_linear_striped_raid_cachepool_error_zero OO: --type cache-pool, OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERT OP: PV ... ID: lvconvert_to_cachepool_or_swap_metadata DESC: Convert LV to type cache-pool (variant, use --type cache-pool). DESC: Swap metadata LV in a cache pool (variant, use --swapmetadata). FLAGS: PREVIOUS_SYNTAX RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long lvconvert --type vdo-pool LV_linear_striped_raid_cache OO: --name LV_new, --virtualsize SizeMB, OO_LVCONVERT_VDO, OO_LVCONVERT ID: lvconvert_to_vdopool DESC: Convert LV to type vdopool. RULE: all and lv_is_visible RULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_virtual lv_is_raid_with_integrity lvconvert --vdopool LV_linear_striped_raid_cache OO: OO_LVCONVERT_VDO, OO_LVCONVERT, --name LV_new, --virtualsize SizeMB, ID: lvconvert_to_vdopool_param DESC: Convert LV to type vdopool. RULE: all and lv_is_visible RULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_virtual lv_is_raid_with_integrity FLAGS: SECONDARY_SYNTAX AUTOTYPE: vdo-pool lvconvert --splitcache LV_cachepool_cache_thinpool_vdopool_writecache OO: OO_LVCONVERT, --cachesettings String ID: lvconvert_split_and_keep_cache DESC: Detach a cache from an LV. lvconvert --uncache LV_cache_thinpool_vdopool_writecache OO: OO_LVCONVERT, --cachesettings String ID: lvconvert_split_and_remove_cache DESC: Detach and delete a cache from an LV. FLAGS: SECONDARY_SYNTAX lvconvert --swapmetadata --poolmetadata LV LV_thinpool_cachepool OO: --chunksize SizeKB, OO_LVCONVERT ID: lvconvert_swap_pool_metadata DESC: Swap metadata LV in a thin pool or cache pool (for repair only). FLAGS: SECONDARY_SYNTAX lvconvert --merge LV_linear_striped_raid_thin_snapshot|VG|Tag ... OO: --background, --interval Number, OO_LVCONVERT ID: lvconvert_merge DESC: Merge LV that was split from a mirror (variant, use --mergemirrors). DESC: Merge thin LV into its origin LV (variant, use --mergethin). DESC: Merge COW snapshot LV into its origin (variant, use --mergesnapshot). RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cow FLAGS: SECONDARY_SYNTAX lvconvert --mergethin LV_thin ... OO: OO_LVCONVERT ID: lvconvert_merge_thin DESC: Merge thin LV into its origin LV. RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cow RULE: all and lv_is_visible lvconvert --mergesnapshot LV_snapshot ... OO: --background, --interval Number, OO_LVCONVERT ID: lvconvert_merge_snapshot DESC: Merge COW snapshot LV into its origin. RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cow RULE: all and lv_is_visible lvconvert --splitsnapshot LV_snapshot OO: OO_LVCONVERT ID: lvconvert_split_cow_snapshot DESC: Separate a COW snapshot from its origin LV. RULE: all not lv_is_locked lv_is_pvmove lv_is_origin lv_is_external_origin lv_is_merging_cow FLAGS: SECONDARY_SYNTAX lvconvert --type snapshot LV LV_linear_striped OO: --snapshot, --chunksize SizeKB, --zero Bool, OO_LVCONVERT ID: lvconvert_combine_split_snapshot DESC: Combine a former COW snapshot (second arg) with a former DESC: origin LV (first arg) to reverse a splitsnapshot command. RULE: all not lv_is_locked lv_is_pvmove RULE: all and lv_is_visible lvconvert --snapshot LV LV_linear_striped OO: --chunksize SizeKB, --zero Bool, OO_LVCONVERT ID: lvconvert_combine_split_snapshot DESC: Combine a former COW snapshot (second arg) with a former DESC: origin LV (first arg) to reverse a splitsnapshot command. RULE: all not lv_is_locked lv_is_pvmove RULE: all and lv_is_visible FLAGS: SECONDARY_SYNTAX AUTOTYPE: snapshot lvconvert --repair LV_cache_cachepool_mirror_raid_thinpool OO: --usepolicies, --interval Number, --poolmetadataspare Bool, OO_LVCONVERT OP: PV ... ID: lvconvert_repair DESC: Replace failed PVs in a raid or mirror LV. DESC: Repair a thin pool. DESC: Repair a cache pool. RULE: all not lv_is_locked lv_is_pvmove RULE: --poolmetadataspare and LV_cache LV_cachepool LV_thinpool lvconvert --replace PV LV_raid OO: OO_LVCONVERT OP: PV ... ID: lvconvert_replace_pv DESC: Replace specific PV(s) in a raid LV with another PV. RULE: all not lv_is_locked lv_is_pvmove lvconvert --startpoll LV_mirror_raid OO: OO_LVCONVERT ID: lvconvert_start_poll DESC: Poll LV to continue conversion. RULE: all and lv_is_converting lvconvert LV_mirror_raid OO: OO_LVCONVERT ID: lvconvert_plain DESC: Poll LV to continue conversion (also see --startpoll) DESC: or waits till conversion/mirror syncing is finished FLAGS: SECONDARY_SYNTAX lvconvert --raidintegrity Bool LV_raid OO: --raidintegritymode String, --raidintegrityblocksize Number, OO_LVCONVERT OP: PV ... ID: lvconvert_integrity DESC: Add or remove data integrity checksums to raid images. OO_LVCREATE: --addtag Tag, --alloc Alloc, --autobackup Bool, --activate Active, --contiguous Bool, --ignoreactivationskip, --ignoremonitoring, --major Number, --metadataprofile String, --minor Number, --monitor Bool, --name String, --nosync, --noudevsync, --permission Permission, --persistent Bool, --readahead Readahead, --reportformat ReportFmt, --setactivationskip Bool, --wipesignatures Bool, --zero Bool, --setautoactivation Bool OO_LVCREATE_CACHE: --cachemode CacheMode, --cachepolicy String, --cachesettings String, --chunksize SizeKB, --cachemetadataformat CacheMetadataFormat OO_LVCREATE_POOL: --poolmetadatasize SizeMB, --poolmetadataspare Bool, --chunksize SizeKB OO_LVCREATE_THINPOOL: --discards Discards, --errorwhenfull Bool OO_LVCREATE_VDO: --compression Bool, --deduplication Bool, --vdosettings String lvcreate --type error --size SizeMB VG OO: OO_LVCREATE ID: lvcreate_error_vol DESC: Create an LV that returns errors when used. FLAGS: SECONDARY_SYNTAX lvcreate --type zero --size SizeMB VG OO: OO_LVCREATE ID: lvcreate_zero_vol DESC: Create an LV that returns zeros when read. FLAGS: SECONDARY_SYNTAX lvcreate --type linear --size SizeMB VG OO: OO_LVCREATE OP: PV ... IO: --mirrors 0, --stripes 1 ID: lvcreate_linear DESC: Create a linear LV. FLAGS: SECONDARY_SYNTAX lvcreate --size SizeMB VG OO: OO_LVCREATE OP: PV ... IO: --mirrors 0, --stripes 1 ID: lvcreate_linear DESC: Create a linear LV. AUTOTYPE: linear lvcreate --type striped --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_striped DESC: Create a striped LV (also see lvcreate --stripes). FLAGS: SECONDARY_SYNTAX lvcreate --stripes Number --size SizeMB VG OO: --stripesize SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_striped DESC: Create a striped LV. AUTOTYPE: striped lvcreate --type mirror --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --mirrors PNumber, --mirrorlog MirrorLog, --regionsize RegionSize, OO_LVCREATE OP: PV ... ID: lvcreate_mirror DESC: Create a mirror LV (also see --type raid1). FLAGS: SECONDARY_SYNTAX lvcreate --mirrors PNumber --size SizeMB VG OO: --stripesize SizeKB, --mirrorlog MirrorLog, --regionsize RegionSize, --minrecoveryrate SizeKB, --maxrecoveryrate SizeKB, OO_LVCREATE OP: PV ... IO: --stripes 1 ID: lvcreate_mirror_or_raid1 DESC: Create a raid1 or mirror LV. AUTOTYPE: raid1 AUTOTYPE: mirror lvcreate --type raid --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --mirrors PNumber, --regionsize RegionSize, --minrecoveryrate SizeKB, --maxrecoveryrate SizeKB, --raidintegrity Bool, --raidintegritymode String, --raidintegrityblocksize Number, OO_LVCREATE OP: PV ... ID: lvcreate_raid_any DESC: Create a raid LV (a specific raid level must be used, e.g. raid1). lvcreate --mirrors PNumber --stripes Number --size SizeMB VG OO: --stripesize SizeKB, --regionsize RegionSize, --minrecoveryrate SizeKB, --maxrecoveryrate SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_raid_any DESC: Create a raid10 LV. AUTOTYPE: raid10 lvcreate --type snapshot --size SizeMB LV OO: --snapshot, --stripes Number, --stripesize SizeKB, --chunksize SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_cow_snapshot DESC: Create a COW snapshot LV of an origin LV DESC: (also see --snapshot). FLAGS: SECONDARY_SYNTAX lvcreate --snapshot --size SizeMB LV OO: --stripes Number, --stripesize SizeKB, --chunksize SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_cow_snapshot DESC: Create a COW snapshot LV of an origin LV. AUTOTYPE: snapshot lvcreate --type snapshot --size SizeMB --virtualsize SizeMB VG OO: --snapshot, --chunksize SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_cow_snapshot_with_virtual_origin DESC: Create a sparse COW snapshot LV of a virtual origin LV DESC: (also see --snapshot). FLAGS: SECONDARY_SYNTAX lvcreate --type thin-pool --size SizeMB VG OO: --thinpool LV_new, --stripes Number, --stripesize SizeKB, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thinpool DESC: Create a thin pool. lvcreate --thin --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thinpool DESC: Create a thin pool. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin-pool lvcreate --size SizeMB --thinpool LV_new VG OO: --stripes Number, --stripesize SizeKB, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thinpool DESC: Create a thin pool named in --thinpool. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin-pool lvcreate --type cache-pool --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... ID: lvcreate_cachepool DESC: Create a cache pool. lvcreate --type cache-pool --size SizeMB --cachepool LV_new VG OO: --stripes Number, --stripesize SizeKB, --cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... ID: lvcreate_cachepool DESC: Create a cache pool named by the --cachepool arg DESC: (variant, uses --cachepool in place of --name). FLAGS: SECONDARY_SYNTAX lvcreate --type thin --virtualsize SizeMB --thinpool LV_thinpool VG OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_vol DESC: Create a thin LV in a thin pool. FLAGS: SECONDARY_SYNTAX lvcreate --type thin --virtualsize SizeMB LV_thinpool OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_vol DESC: Create a thin LV in a thin pool named in the first arg DESC: (variant, also see --thinpool for naming pool). FLAGS: SECONDARY_SYNTAX lvcreate --virtualsize SizeMB --thinpool LV_thinpool VG OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_vol DESC: Create a thin LV in a thin pool. AUTOTYPE: thin lvcreate --virtualsize SizeMB LV_thinpool OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_vol DESC: Create a thin LV in the thin pool named in the first arg DESC: (also see --thinpool for naming pool.) FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin lvcreate --type thin LV_thin OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_snapshot DESC: Create a thin LV that is a snapshot of an existing thin LV. FLAGS: SECONDARY_SYNTAX lvcreate --thin LV_thin OO: OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_snapshot DESC: Create a thin LV that is a snapshot of an existing thin LV. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin lvcreate --snapshot LV_thin OO: OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_snapshot DESC: Create a thin LV that is a snapshot of an existing thin LV. AUTOTYPE: thin lvcreate --type thin --thinpool LV_thinpool LV OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_snapshot_of_external DESC: Create a thin LV that is a snapshot of an external origin LV. lvcreate --snapshot --thinpool LV_thinpool LV OO: OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_snapshot_of_external DESC: Create a thin LV that is a snapshot of an external origin LV. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin lvcreate --type vdo --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --vdo, --virtualsize SizeMB, --vdopool LV_new, OO_LVCREATE_VDO, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_vdo_vol DESC: Create a LV that returns VDO when used. lvcreate --vdo --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --virtualsize SizeMB, --vdopool LV_new, OO_LVCREATE_VDO, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_vdo_vol DESC: Create a VDO LV with VDO pool. FLAGS: SECONDARY_SYNTAX AUTOTYPE: vdo lvcreate --vdopool LV_new --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --virtualsize SizeMB, OO_LVCREATE_VDO, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_vdo_vol DESC: Create a VDO LV with VDO pool. FLAGS: SECONDARY_SYNTAX AUTOTYPE: vdo lvcreate --type thin --virtualsize SizeMB --size SizeMB --thinpool LV_new VG OO: --stripes Number, --stripesize SizeKB, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thin_vol_and_thinpool DESC: Create a thin LV, first creating a thin pool for it, DESC: where the new thin pool is named by the --thinpool arg. FLAGS: SECONDARY_SYNTAX lvcreate --virtualsize SizeMB --size SizeMB --thinpool LV_new VG OO: --stripes Number, --stripesize SizeKB, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thin_vol_and_thinpool DESC: Create a thin LV, first creating a thin pool for it, DESC: where the new thin pool is named by --thinpool. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin lvcreate --type thin --virtualsize SizeMB --size SizeMB LV_new|VG OO: --stripes Number, --stripesize SizeKB, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thin_vol_and_thinpool DESC: Create a thin LV, first creating a thin pool for it, DESC: where the new thin pool is named in the first arg, DESC: or the new thin pool name is generated when the first DESC: arg is a VG name. FLAGS: SECONDARY_SYNTAX lvcreate --thin --virtualsize SizeMB --size SizeMB LV_new|VG OO: --stripes Number, --stripesize SizeKB, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thin_vol_and_thinpool DESC: Create a thin LV, first creating a thin pool for it, DESC: where the new thin pool is named in the first arg, DESC: or the new thin pool name is generated when the first DESC: arg is a VG name. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin lvcreate --size SizeMB --virtualsize SizeMB VG OO: --stripes Number, --stripesize SizeKB, --snapshot, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thin_vol_with_thinpool_or_sparse_snapshot DESC: Create a thin LV, first creating a thin pool for it. DESC: Create a sparse snapshot of a virtual origin LV DESC: Chooses type thin or snapshot according to DESC: config setting sparse_segtype_default. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin AUTOTYPE: snapshot lvcreate --type cache --size SizeMB --cachepool LV_cachepool VG OO: --stripes Number, --stripesize SizeKB, --cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... ID: lvcreate_and_attach_cachepool DESC: Create a new LV, then attach the specified cachepool DESC: which converts the new LV to type cache. lvcreate --size SizeMB --cachepool LV_cachepool VG OO: --stripes Number, --stripesize SizeKB, --cache, OO_LVCREATE_CACHE, OO_LVCREATE OP: PV ... ID: lvcreate_and_attach_cachepool_v2 DESC: Create a new LV, then attach the specified cachepool DESC: which converts the new LV to type cache. FLAGS: SECONDARY_SYNTAX AUTOTYPE: cache lvcreate --type cache --size SizeMB LV_cachepool OO: --stripes Number, --stripesize SizeKB, --cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... ID: lvcreate_and_attach_cachepool_v3 DESC: Create a new LV, then attach the specified cachepool DESC: which converts the new LV to type cache. DESC: (variant, also use --cachepool). FLAGS: SECONDARY_SYNTAX lvcreate --cache --size SizeMB LV OO: OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE, --stripes Number, --stripesize SizeKB OP: PV ... ID: lvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepool DESC: When the LV arg is a cachepool, then create a new LV and DESC: attach the cachepool arg to it. DESC: (variant, use --type cache and --cachepool.) DESC: When the LV arg is not a cachepool, then create a new cachepool DESC: and attach it to the LV arg (alternative, use lvconvert.) FLAGS: SECONDARY_SYNTAX AUTOTYPE: cache lvcreate --type cache --size SizeMB --cachevol LV VG OO: --stripes Number, --stripesize SizeKB, OO_LVCREATE_CACHE, OO_LVCREATE OP: PV ... ID: lvcreate_and_attach_cachevol_for_cache DESC: Create a new LV, then attach the specified cachevol DESC: which converts the new LV to type cache. lvcreate --type cache --size SizeMB --cachedevice PV VG OO: --stripes Number, --stripesize SizeKB, --cachesize SizeMB, OO_LVCREATE_CACHE, OO_LVCREATE OP: PV ... ID: lvcreate_and_attach_cachedevice_for_cache DESC: Create a new LV, then attach a cachevol created from DESC: the specified cache device, which converts the DESC: new LV to type cache. lvcreate --type writecache --size SizeMB --cachevol LV VG OO: OO_LVCREATE, --cachesettings String, --stripes Number, --stripesize SizeKB OP: PV ... ID: lvcreate_and_attach_cachevol_for_writecache DESC: Create a new LV, then attach the specified cachevol DESC: which converts the new LV to type writecache. lvcreate --type writecache --size SizeMB --cachedevice PV VG OO: OO_LVCREATE, --cachesize SizeMB, --cachesettings String, --stripes Number, --stripesize SizeKB OP: PV ... ID: lvcreate_and_attach_cachedevice_for_writecache DESC: Create a new LV, then attach a cachevol created from DESC: the specified cache device, which converts the DESC: new LV to type writecache. lvdisplay OO: --aligned, --all, --binary, --colon, --columns, --configreport ConfigReport, --foreign, --history, --ignorelockingfailure, --logonly, --maps, --noheadings, --nosuffix, --options String, --sort String, --readonly, --segments, --select String, --separator String, --shared, --unbuffered, --units Units OP: VG|LV|Tag ... IO: --partial, --ignoreskippedcluster, --reportformat ReportFmt ID: lvdisplay_general lvextend --size PSizeMB LV OO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB, --poolmetadatasize PSizeMB, --type SegType OP: PV ... ID: lvextend_by_size DESC: Extend an LV by a specified size. lvextend LV PV ... OO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB, --type SegType ID: lvextend_by_pv DESC: Extend an LV by specified PV extents. lvextend --poolmetadatasize PSizeMB LV_thinpool OO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --stripes Number, --stripesize SizeKB, --type SegType OP: PV ... ID: lvextend_pool_metadata_by_size DESC: Extend a pool metadata SubLV by a specified size. lvextend --usepolicies LV_thinpool_snapshot OO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs, --type SegType OP: PV ... ID: lvextend_by_policy DESC: Extend an LV according to a predefined policy. lvmconfig OO: OO_CONFIG OP: String ... ID: lvmconfig_general lvmdevices ID: lvmdevices_list DESC: Print devices in the devices file. lvmdevices --check ID: lvmdevices_check DESC: Check the devices file and report incorrect values. lvmdevices --update ID: lvmdevices_update DESC: Update the devices file to fix incorrect values. lvmdevices --adddev PV OO: --deviceidtype String ID: lvmdevices_edit DESC: Add a device to the devices file. lvmdevices --deldev PV ID: lvmdevices_edit DESC: Remove a device from the devices file. lvmdevices --addpvid String OO: --deviceidtype String ID: lvmdevices_edit DESC: Find the device with the given PVID and add it to the devices file. lvmdevices --delpvid String ID: lvmdevices_edit DESC: Remove the devices file entry for the given PVID. lvreduce --size NSizeMB LV OO: --autobackup Bool, --force, --nofsck, --noudevsync, --reportformat ReportFmt, --resizefs ID: lvreduce_general lvremove VG|LV|Tag|Select ... OO: --autobackup Bool, --force, --nohistory, --noudevsync, --reportformat ReportFmt, --select String ID: lvremove_general lvrename VG LV LV_new OO: --autobackup Bool, --noudevsync, --reportformat ReportFmt ID: lvrename_vg_lv_lv lvrename LV LV_new OO: --autobackup Bool, --noudevsync, --reportformat ReportFmt ID: lvrename_lv_lv lvresize --size SSizeMB LV OO: --alloc Alloc, --autobackup Bool, --force, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB, --poolmetadatasize PSizeMB, --type SegType OP: PV ... ID: lvresize_by_size DESC: Resize an LV by a specified size. lvresize LV PV ... OO: --alloc Alloc, --autobackup Bool, --force, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB, --type SegType ID: lvresize_by_pv DESC: Resize an LV by specified PV extents. lvresize --poolmetadatasize PSizeMB LV_thinpool OO: --alloc Alloc, --autobackup Bool, --force, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --stripes Number, --stripesize SizeKB, --type SegType OP: PV ... ID: lvresize_pool_metadata_by_size DESC: Resize a pool metadata SubLV by a specified size. lvs OO: --history, --segments, OO_REPORT OP: VG|LV|Tag ... IO: --partial, --ignoreskippedcluster, --trustcache ID: lvs_general lvscan OO: --all, --blockdevice, --ignorelockingfailure, --readonly, --reportformat ReportFmt IO: --partial, --cache_long ID: lvscan_general OO_PVCHANGE: --autobackup Bool, --force, --reportformat ReportFmt, --uuid OO_PVCHANGE_META: --allocatable Bool, --addtag Tag, --deltag Tag, --uuid, --metadataignore Bool pvchange --all OO_PVCHANGE_META OO: OO_PVCHANGE IO: --ignoreskippedcluster ID: pvchange_properties_all DESC: Change properties of all PVs. pvchange OO_PVCHANGE_META PV|Select ... OO: --select String, OO_PVCHANGE IO: --ignoreskippedcluster ID: pvchange_properties_some DESC: Change properties of specified PVs. pvresize PV ... OO: --setphysicalvolumesize SizeMB, --reportformat ReportFmt ID: pvresize_general pvck PV ... OO: --labelsector Number ID: pvck_general DESC: Check for metadata on a device pvck --dump DumpType PV OO: --settings String, --file String, --pvmetadatacopies MetadataCopiesPV, --labelsector Number ID: pvck_dump DESC: Check and print LVM headers and metadata on a device pvck --repairtype RepairType PV OO: --settings String, --file String, --labelsector Number ID: pvck_repair_type DESC: Repair LVM headers or metadata on a device pvck --repair --file String PV OO: --settings String, --labelsector Number ID: pvck_repair DESC: Repair LVM headers and metadata on a device pvcreate PV ... OO: --dataalignment SizeKB, --dataalignmentoffset SizeKB, --bootloaderareasize SizeMB, --force, --labelsector Number, --metadatatype MetadataType, --pvmetadatacopies MetadataCopiesPV, --metadatasize SizeMB, --metadataignore Bool, --norestorefile, --setphysicalvolumesize SizeMB, --reportformat ReportFmt, --restorefile String, --uuidstr String, --zero Bool ID: pvcreate_general RULE: --norestorefile not --restorefile RULE: --bootloaderareasize not --restorefile pvdisplay OO: --aligned, --all, --binary, --colon, --columns, --configreport ConfigReport, --foreign, --ignorelockingfailure, --logonly, --maps, --noheadings, --nosuffix, --options String, --readonly, --select String, --separator String, --shared, --short, --sort String, --unbuffered, --units Units OP: PV|Tag ... IO: --ignoreskippedcluster, --reportformat ReportFmt ID: pvdisplay_general pvmove PV OO: --abort, --alloc Alloc, --atomic, --autobackup Bool, --background, --interval Number, --name LV, --noudevsync, --reportformat ReportFmt OP: PV ... ID: pvmove_one DESC: Move PV extents. pvmove OO: --abort, --background, --interval Number ID: pvmove_any DESC: Continue or abort existing pvmove operations. pvremove PV ... OO: --force, --reportformat ReportFmt ID: pvremove_general pvs OO: --segments, OO_REPORT OP: PV|Tag ... IO: --partial, --ignoreskippedcluster, --trustcache ID: pvs_general pvscan OO: --ignorelockingfailure, --reportformat ReportFmt, --exported, --novolumegroup, --short, --uuid ID: pvscan_display DESC: Display PV information. pvscan --cache_long OO: --ignorelockingfailure, --reportformat ReportFmt, --major Number, --minor Number, --noudevsync OP: PV|String ... IO: --background ID: pvscan_cache DESC: Record that a PV is online or offline. pvscan --cache_long --activate ay OO: --ignorelockingfailure, --reportformat ReportFmt, --major Number, --minor Number, --noudevsync OP: PV|String ... IO: --background ID: pvscan_cache DESC: Record that a PV is online and autoactivate the VG if complete. pvscan --cache_long --listvg PV OO: --ignorelockingfailure, --checkcomplete, --vgonline, --udevoutput ID: pvscan_cache DESC: Record that a PV is online and list the VG using the PV. pvscan --cache_long --listlvs PV OO: --ignorelockingfailure, --checkcomplete, --vgonline ID: pvscan_cache DESC: Record that a PV is online and list LVs using the PV. pvscan --listlvs PV ID: pvscan_cache DESC: List LVs using the PV. pvscan --listvg PV ID: pvscan_cache DESC: List the VG using the PV. vgcfgbackup OO: --file String, --foreign, --ignorelockingfailure, --readonly, --reportformat ReportFmt OP: VG ... IO: --partial ID: vgcfgbackup_general OO_VGCFGRESTORE: --force_long, --metadatatype MetadataType vgcfgrestore VG OO: OO_VGCFGRESTORE ID: vgcfgrestore_by_vg DESC: Restore VG metadata from last backup. vgcfgrestore --file String VG OO: OO_VGCFGRESTORE ID: vgcfgrestore_by_file DESC: Restore VG metadata from specified file. vgcfgrestore --list VG OO: OO_VGCFGRESTORE ID: vgcfgrestore_list_by_vg DESC: List all VG metadata backups. vgcfgrestore --list --file String OO: OO_VGCFGRESTORE OP: VG ID: vgcfgrestore_list_by_file DESC: List one VG metadata backup file. OO_VGCHANGE: --autobackup Bool, --ignoremonitoring, --noudevsync, --reportformat ReportFmt, --select String, --force OO_VGCHANGE_META: --addtag Tag, --deltag Tag, --logicalvolume Uint32, --maxphysicalvolumes Uint32, --alloc Alloc, --uuid, --pvmetadatacopies MetadataCopiesPV, --vgmetadatacopies MetadataCopiesVG, --physicalextentsize SizeMB, --resizeable Bool, --profile String, --detachprofile, --metadataprofile String, --setautoactivation Bool vgchange OO_VGCHANGE_META OO: --poll Bool, OO_VGCHANGE OP: VG|Tag|Select ... IO: --ignoreskippedcluster ID: vgchange_properties DESC: Change a general VG attribute. DESC: For options listed in parentheses, any one is DESC: required, after which the others are optional. vgchange --monitor Bool OO: --sysinit, --ignorelockingfailure, --poll Bool, OO_VGCHANGE OP: VG|Tag|Select ... IO: --ignoreskippedcluster ID: vgchange_monitor DESC: Start or stop monitoring LVs from dmeventd. vgchange --poll Bool OO: --ignorelockingfailure, OO_VGCHANGE OP: VG|Tag|Select ... IO: --ignoreskippedcluster ID: vgchange_poll DESC: Start or stop processing LV conversions. vgchange --activate Active OO: --activationmode ActivationMode, --ignoreactivationskip, --partial, --sysinit, --readonly, --ignorelockingfailure, --monitor Bool, --poll Bool, OO_VGCHANGE OP: VG|Tag|Select ... IO: --ignoreskippedcluster ID: vgchange_activate DESC: Activate or deactivate LVs. vgchange --refresh OO: --sysinit, --ignorelockingfailure, --poll Bool, OO_VGCHANGE OP: VG|Tag|Select ... IO: --ignoreskippedcluster ID: vgchange_refresh DESC: Reactivate LVs using the latest metadata. vgchange --systemid String VG ID: vgchange_systemid DESC: Change the system ID of a VG. vgchange --lockstart OO: --select String OP: VG|Tag|Select ... ID: vgchange_lockstart DESC: Start the lockspace of a shared VG in lvmlockd. vgchange --lockstop OO: --select String OP: VG|Tag|Select ... ID: vgchange_lockstop DESC: Stop the lockspace of a shared VG in lvmlockd. vgchange --locktype LockType VG ID: vgchange_locktype DESC: Change the lock type for a shared VG. vgck OO: --reportformat ReportFmt OP: VG|Tag ... ID: vgck_general DESC: Read and display information about a VG. vgck --updatemetadata VG ID: vgck_update_metadata DESC: Rewrite VG metadata to correct problems. vgcreate VG_new PV ... OO: --addtag Tag, --alloc Alloc, --autobackup Bool, --clustered Bool, --maxlogicalvolumes Uint32, --maxphysicalvolumes Uint32, --metadataprofile String, --metadatatype MetadataType, --physicalextentsize SizeMB, --force, --zero Bool, --labelsector Number, --metadatasize SizeMB, --pvmetadatacopies MetadataCopiesPV, --vgmetadatacopies MetadataCopiesVG, --reportformat ReportFmt, --dataalignment SizeKB, --dataalignmentoffset SizeKB, --shared, --systemid String, --locktype LockType, --setautoactivation Bool ID: vgcreate_general vgdisplay OO: --activevolumegroups, --aligned, --binary, --colon, --columns, --configreport ConfigReport, --foreign, --ignorelockingfailure, --logonly, --noheadings, --nosuffix, --options String, --readonly, --select String, --shared, --short, --separator String, --sort String, --unbuffered, --units Units OP: VG|Tag ... IO: --partial, --ignoreskippedcluster, --reportformat ReportFmt ID: vgdisplay_general OO_VGEXPORT: --reportformat ReportFmt vgexport VG|Tag|Select ... OO: --select String, OO_VGEXPORT ID: vgexport_some DESC: Export specified VGs. vgexport --all OO: OO_VGEXPORT ID: vgexport_all DESC: Export all VGs. vgextend VG PV ... OO: --autobackup Bool, --force, --zero Bool, --labelsector Number, --metadatatype MetadataType, --metadatasize SizeMB, --pvmetadatacopies MetadataCopiesPV, --metadataignore Bool, --dataalignment SizeKB, --dataalignmentoffset SizeKB, --reportformat ReportFmt, --restoremissing ID: vgextend_general OO_VGIMPORT: --force, --reportformat ReportFmt vgimport VG|Tag|Select ... OO: --select String, OO_VGIMPORT ID: vgimport_some DESC: Import specified VGs. vgimport --all OO: OO_VGIMPORT ID: vgimport_all DESC: Import all VGs. vgimportclone PV ... OO: --basevgname VG, --import, --importdevices ID: vgimportclone_general vgimportdevices VG|Tag|Select ... OO: --select String, --foreign, --reportformat ReportFmt ID: vgimportdevices_some DESC: Add devices from specific VGs to the devices file. vgimportdevices --all OO: --foreign, --reportformat ReportFmt ID: vgimportdevices_all DESC: Add devices from all accessible VGs to the devices file. vgmerge VG VG OO: --autobackup Bool, --list, --poolmetadataspare Bool ID: vgmerge_general vgmknodes OO: --ignorelockingfailure, --refresh, --reportformat ReportFmt OP: VG|LV|Tag ... ID: vgmknodes_general OO_VGREDUCE: --autobackup Bool, --force, --reportformat ReportFmt vgreduce VG PV ... OO: OO_VGREDUCE ID: vgreduce_by_pv DESC: Remove a PV from a VG. vgreduce --all VG OO: OO_VGREDUCE ID: vgreduce_all DESC: Remove all unused PVs from a VG. vgreduce --removemissing VG OO: --mirrorsonly, OO_VGREDUCE ID: vgreduce_missing DESC: Remove all missing PVs from a VG. vgremove VG|Tag|Select ... OO: --force, --noudevsync, --reportformat ReportFmt, --select String ID: vgremove_general vgrename VG VG_new OO: --autobackup Bool, --force, --reportformat ReportFmt ID: vgrename_by_name DESC: Rename a VG. vgrename String VG_new OO: --autobackup Bool, --force, --reportformat ReportFmt ID: vgrename_by_uuid DESC: Rename a VG by specifying the VG UUID. vgs OO: OO_REPORT OP: VG|Tag ... IO: --partial, --ignoreskippedcluster, --trustcache ID: vgs_general vgscan OO: --ignorelockingfailure, --mknodes, --notifydbus, --reportformat ReportFmt IO: --partial, --cache_long ID: vgscan_general OO_VGSPLIT: --autobackup Bool, --poolmetadataspare Bool OO_VGSPLIT_NEW: --alloc Alloc, --maxlogicalvolumes Uint32, --maxphysicalvolumes Uint32, --metadatatype MetadataType, --vgmetadatacopies MetadataCopiesVG vgsplit VG VG PV ... OO: OO_VGSPLIT, OO_VGSPLIT_NEW ID: vgsplit_by_pv DESC: Split a VG by specified PVs. vgsplit --name LV VG VG OO: OO_VGSPLIT, OO_VGSPLIT_NEW ID: vgsplit_by_lv DESC: Split a VG by PVs in a specified LV. config OO: OO_CONFIG OP: String ... ID: lvmconfig_general dumpconfig OO: OO_CONFIG OP: String ... ID: lvmconfig_general devtypes OO: --aligned, --binary, --nameprefixes, --noheadings, --nosuffix, --options String, --reportformat ReportFmt, --rows, --select String, --separator String, --sort String, --unbuffered, --unquoted ID: devtypes_general fullreport OO: OO_REPORT OP: VG ... IO: --partial, --ignoreskippedcluster, --trustcache ID: fullreport_general lastlog OO: --reportformat ReportFmt, --select String ID: lastlog_general lvpoll --polloperation PollOp LV ... OO: --abort, --autobackup Bool, --handlemissingpvs, --interval Number ID: lvpoll_general formats ID: formats_general help OP: String ... ID: help_general version ID: version_general pvdata ID: pvdata_general segtypes ID: segtypes_general systemid ID: systemid_general tags ID: tags_general lvmchange ID: lvmchange_general lvmdiskscan OO: --lvmpartition, --readonly ID: lvmdiskscan_general lvmsadc ID: lvmsadc_general lvmsar OO: --full, --stdin ID: lvmsar_general vgconvert VG ... OO: --force, --labelsector Number, --bootloaderareasize SizeMB, --metadatatype MetadataType, --pvmetadatacopies MetadataCopiesPV, --metadatasize SizeMB, --reportformat ReportFmt ID: vgconvert_general *dumpconfig.ccurrentdiffIncorrect version format.Failed to load profile %s.LVM configuration valid.LVM configuration invalid.profilableprofilable-commandprofilable-metadataOnly one of --type and --validate permitted.Only one of --type and --list permitted.Only one of --atversion and --sinceversion permitted.--atversion requires --type or --list--sinceversion requires --type newOnly one of --ignoreunsupported and --showunsupported permitted.--atversion has no effect with --type %s--ignoreadvanced and --ignoreunsupported has no effect with --type current--mergedconfig has no effect without --type current or --type fullFailed to merge configuration.--withcomments has no effect with --type list--withlocalpreamble has no effect with --type list--withgeneralpreamble has no effect with --type listIncorrect type of configuration specified. Expected one of: current, default, diff, full, list, missing, new, profilable, profilable-command, profilable-metadata.lvchange.c and %u other snapshot(s)Failed to prepare message.%s device number not changed.Cannot deactivate %s.%s: reactivation failed.(inherited)%s:yLogical volume %s changed.No settings changed.Polling LV %sMonitoring LV %sUnmonitoring LV %sdisk-logged core-logged clustered Failed to clear %s %s for %s.intermediateNo --rebuild found!Updating %s%slogical volume %s on disk(s).Failed to update %smetadata of %s on disk.Do you want to activate component LV in read-only mode? [y/n]: Allowing activation of component LV.Operation not permitted on hidden LV %s.Change of snapshot %s will also change its origin %s%s. Proceed? [y/n]: Logical volume %s not changed.Cannot activate LVs in a foreign VG.Internal error: Missing syncaction arg.Use syncaction check to detect and correct integrity checksum mismatches.Minor number is already not persistent for %s.Disabling persistent device number for %s.Logical volume %s will be deactivated temporarily. Continue? [y/n]: Setting persistent device number to (%d, %d) for %s.Re-activating logical volume %s.Logical volume %s is already read-only. Refreshing kernel state.Logical volume "%s" is already read only.Logical volume %s is already writable. Refreshing kernel state.Logical volume %s is already writable.Setting logical volume %s read/write.Setting logical volume %s read-only.Allocation policy of logical volume %s is already %s.Setting contiguous allocation policy for %s to %s.Updating logical volume %s on disk(s).Error when full is already %sset for %s.WARNING: Overriding readahead to %u sectors, a multiple of %uK page size.Read ahead is already auto for %s.Read ahead is already %u for %s.Setting read ahead to %u for %s.Unable to change write%s on %s while it is not in-sync.%s not found in volume group, %sCan't set all images of %s LV %s to writemostly.Minimum recovery rate cannot be higher than maximum.Changing configuration profile for LV %s: %s -> %s.Changing activation skip flag to %s for LV %s.Changing autoactivation flag to %s for LV %s.Unable to change compression for non VDO volume %s.Logical volume %s already uses --compression %c.Unable to change deduplication for non VDO volume %s.Logical volume %s already uses --deduplication %c.Internal error: Failed to check for option %sCannot change support for discards while pool volume %s is active.Logical volume %s already uses --discards %s.Logical volume %s already %szero new blocks.Cannot change existing block size %u bytes.Clear all writecache settings? WARNING: repairing a damaged cachevol is not yet possible.WARNING: cache mode writethrough is suggested for safe operation.Continue using writeback without repair?Cache %s is not clean, refusing to switch cache mode.Cannot change VDO settings for active VDO pool %s.VDO pool %s with all its LVs needs to be deactivated.Logical volume %s is not active.Refreshing logical volume %s (if active).Can't resync open logical volume %s.Do you really want to deactivate logical volume %s to resync it? [y/n]: Logical volume %s not resynced.Unable to deactivate %s for resync.Starting resync of %s%s%s%s %s.Failed to reactivate %s to resynchronize mirror.Failed to reattach %s device after clearing.Failed to reactivate %s after resync.RAID logical volume %s cannot be active remotely.Do you really want to rebuild %u PVs of logical volume %s [y/n]: Logical volume %s not rebuild.WARNING: Combining activation change with other commands is not advised.Cannot change LV properties when activating component LVs.Internal error: Missing function for command definition %d:%s.Allocation of list of failed_pvs failed.Allocation of failed_pvs list entry failed.Thin repair commnand is not configured. Repair is disabled.Failed to build thin metadata path.Failed to build pool metadata spare path.Internal error: Unable to find configuration for global/thin_repair_optionsInvalid string in config file: global/thin_repair_optionsToo many options for thin repair command.Active pools cannot be repaired. Use lvchange -an first.Cannot activate pool metadata spare volume %s.Cannot activate thin pool metadata volume %s.Cannot deactivate pool metadata spare volume %s.Repair of thin metadata volume of thin pool %s failed (status:%d). Manual repair required!WARNING: Cannot read output from %s %s.Transaction id %lu from pool "%s/%s" does not match repaired transaction id %lu from %s.Cannot deactivate thin pool metadata volume %s.Can't prepare new metadata name for %s.Can't generate new name for %s.WARNING: LV %s holds a backup of the unrepaired metadata. Use lvremove when no longer required.WARNING: New metadata LV %s might use different PVs. Move it with pvmove if required.Cache repair commnand is not configured. Repair is disabled.Failed to build cache metadata path.Internal error: Unable to find configuration for global/cache_repair_optionsInvalid string in config file: global/cache_repair_optionsToo many options for cache repair command.Only inactive cache can be repaired.Cannot activate cache pool metadata volume %s.Repair of cache metadata volume of cache %s failed (status:%d). Manual repair required!Cannot deactivate pool metadata volume %s.WARNING: If everything works, remove %s volume.WARNING: Use pvmove command to move %s on the best fitting PV.lvconvert: layer name creation failed.lvconvert: layer name generation failed.Failed to get '--replace' argumentUnable to combine split snapshots in VG with lock_type %sUnable to use %s as both snapshot and origin.Chunk size must be a power of 2 in the range 4K to 512K.Couldn't find origin volume %s in Volume group %s.Cannot use logical volume %s with active component LVs for snapshot origin.WARNING: Converting logical volume %s to snapshot exception store.THIS WILL DESTROY CONTENT OF LOGICAL VOLUME (filesystem etc.)Do you really want to convert %s? [y/n]: Couldn't deactivate logical volume %s.Aborting. Failed to wipe snapshot exception store.Logical volume %s converted to snapshot.Operation not permitted on LV %s type %s.Unable to swap pool metadata in VG with lock_type %sCan't use same LV for pool data and metadata LV %s.LV %s with type %s cannot be used as a metadata LV.Pool metadata LV %s is of an unsupported type.Cannot convert pool %s with active volumes.Failed to create internal lv names, pool name is too long.Chunk size can be only changed with --force. Conversion aborted.WARNING: Changing chunk size %s to %s for %s pool volume.Do you really want to change chunk size for %s pool volume? [y/n]: Do you want to swap metadata of %s pool with metadata volume %s? [y/n]: Aborting. Failed to deactivate %s.%s is not a mergeable logical volume.Cannot merge snapshot %s into the origin %s with merging snapshot %s.Internal error: %s is missing origin.%s is read-only external origin %s.Merging into the old snapshot origin %s is not supported.Delaying merge since snapshot is open.Delaying merge since origin volume is open.Failed to reactivate origin %s.Merging of thin snapshot %s will occur on next activation of %s.Detaching cachevol %s from LV %s.WARNING: writeback cache on %s is not complete and cannot be flushed.WARNING: cannot detach writeback cache from %s without --force.WARNING: Data may be lost by detaching writeback cache without flushing.Detach writeback cache %s from %s without flushing data?Unable to convert VDO pool in VG with lock_type %sAborting. Failed to wipe VDO data store.Converted %s to VDO pool volume and created virtual %s VDO volume.WARNING: Converting logical volume %s to VDO pool volume %s formating.WARNING: Using invalid VDO pool data MAY DESTROY YOUR DATA!Writecache requires consistent logical block size for LV devices.Writecache block size %u not allowed with device logical block size 4096.Using writecache block size %u for thin pool data, logical block size %u, physical block size %u.Test mode skips checking fs block size.Using writecache block size %u for unknown file system block size, logical block size %u, physical block size %u.WARNING: unable to detect a file system block size on %sWARNING: using a writecache block size larger than the file system block size may corrupt the file system.Use writecache block size %u? [y/n]: Writecache block size %u cannot be larger than file system block size %u.Internal error: Wrong params for lvconvert _create_id.Internal error: Name "%s/%s" is too long.Poll operation ID allocation failed.Failed to copy one or more poll operation ID members.Convert poll ID list allocation failed.Converting thin%s segment type for %s to %s is not supported.For pool data volume conversion use %s.For pool metadata volume conversion use %s.Internal error: Volume %s is not a COW.Unable to split off snapshot %s with virtual origin.Unable to split snapshots in VG with lock_type %s.Do you really want to split off active logical volume %s? [y/n]: Splitting snapshot %s from its origin.Logical Volume %s split from its origin.Conversion of tracking raid1 LV %s is not supported.Failed to find RaidLV of RAID subvolume %s.Conversion of tracked raid1 subvolume %s is not supported.Internal error: LV %s is already a pool.Use a different LV for pool metadata %s.Mirror logical volumes cannot be used for pool metadata.Try "%s" segment type instead.Pool metadata LV %s is too small (%u extents) for required metadata (%u extents).WARNING: Using mismatched cache pool metadata MAY DESTROY YOUR DATA!Aborting. Failed to activate metadata lv.Aborting. Failed to wipe metadata lv.Aborting. Failed to deactivate metadata lv. Manual intervention required.Aborting. Failed to deactivate logical volume %s.Failed to activate pool logical volume %s.Failed to deactivate pool data logical volume %s.Failed to deactivate pool metadata logical volume %s.Failed to unlock pool data LV %s/%sFailed to unlock pool metadata LV %s/%sWARNING: Converting %s to %s pool's data%s %s metadata wiping.Pool metadata extents %u chunk_size %uInternal error: Invalid lvconvert pool commandInternal error: Invalid lvconvert pool command.LV %s with type %s cannot be used as a %s pool LV.Cannot convert logical volume %s under snapshot.The --poolmetadata option is required to swap metadata.LV %s with type %s cannot be converted to a cache pool.LV %s is already used as a cachevol.Use a different LV for cache pool LV and cache LV %s.LV %s could not be converted to a cache pool.Internal error: LV %s is not a cache pool data volume.Cache pool %s is already in use.Do you want wipe existing metadata of cache pool %s? [y/n]: To preserve cache metadata add option "--zero n".WARNING: Reusing mismatched cache pool metadata MAY DESTROY YOUR DATA!WARNING: Reusing cache pool metadata %s for volume caching.Redirecting operation to data sub LV %s.Can't use same LV %s for thin pool and thin volume.Can't use lock_type %s LV as external origin.Aborting. Unable to deactivate new LV. Manual intervention required.Converted %s to thin volume with external origin %s.Unable to deactivate failed new LV. Manual intervention required.LV %s with type %s cannot be converted to a thin pool.Use a different LV for thin pool LV and thin LV %s.LV %s could not be converted to a thin pool.Internal error: LV %s cannot be found.Internal error: LV %s is not a thin pool.Cannot convert cache volume %s with %s cache mode to external origin.To proceed, run 'lvchange --cachemode writethrough %s'.Cache %s is not clean, refusing to convert to external origin.Cannot add integrity while LV is missing PVs.Logical volume %s has added integrity.Logical volume %s has removed integrity.With tag as cachedevice, --cachesize is required.PV %s is in use, --cachesize is required.Use all %s from %s for cache? [y/n]: Use --cachesize SizeMB to use a part of the cachedevice.Cannot allocate from more than %u cache devices.No cachedevice specified to create a cachevol.cachedevice not found in VG %s.Failed to create cachevol LV name.Failed to generate cachevol LV format.Failed to generate cachevol LV name.Creating cachevol LV %s with size %s.Erase all existing data on %s? [y/n]: Can't prepare new cachevol name for %s.Failed to unlock fast LV %s/%sCannot find LV with cache from %s.WARNING: writecache on %s is not complete and cannot be flushed.WARNING: cannot detach writecache from %s without --force.WARNING: Data may be lost by detaching writecache without flushing.Detach writecache %s from %s without flushing data?Detaching writecache skipping cleaner...Detaching writecache without cleaner...Failed to activate LV to clean writecache.Detaching writecache already clean.Detaching writecache setting cleaner.Failed to set cleaner cachesetting to flush cache.See lvchange --cachesettings cleaner=1Detaching writecache finished cleaning.Failed to monitor writecache cleaner progress.Logical volume %s writecache has been detached.Logical volume %s is not cached and %s is removed.Logical volume %s is not cached and %s is unused.Internal error: Unknown cache split command.WARNING: Cache origin logical volume %s is missing.WARNING: Cache pool data logical volume %s is missing.WARNING: Cache pool metadata logical volume %s is missing.Cannot uncache writeback cache volume %s without --force.WARNING: Uncaching of partially missing %s cache volume %s might destroy your data.Do you really want to uncache %s with missing LVs? [y/n]: Logical volume %s is not cached.Detaching cachepool %s from LV %s.Cannot split cache pool while PVs are missing, see --uncache to delete cache pool.Cannot convert %s LV %s to %s.Cannot specify mirrors with linear type.Unable to %s images by specified amount.Exactly one image must be split off from %s when tracking changes.--corelog and --mirrorlog are only compatible with mirror devicesOnly up to %u mirrors in %s LV %s supported currently.Cannot add raid images with integrity for this raid level.Logical volume %s successfully converted.RAID module does not support RAID0.RAID module does not support RAID10.This conversion is not supported for raid with integrity.LV %s must be linear to use as a writecache.LV %s must be inactive to attach.Failed to sync local dev names.Unknown memory usage for unknown writecache block_size_sectors %uWARNING: writecache size %s will use %llu GiB of system memory (%llu GiB).Continue adding writecache? [y/n]: Cannot initialize readonly LV %sFailed to activate LV %s for zeroing.Failed to deactivate LV %s for zeroing.Logical volume %s now has writecache.Cannot merge snapshot %s into the read-only external origin %s.Cannot merge snapshot %s into the read-only origin %s. (Use lvchange -p rw).Unable to merge invalidated snapshot LV %s.Can't initialize snapshot merge. Missing support in kernel?Delaying merge since origin is open.Conversion starts after activation.Merging of snapshot %s will occur on next activation of %s.WARNING: Logical volume %s is already not mirrored.Cannot convert logical volume %s with active component LV(s).Can't add mirror to out-of-sync mirrored LV: use lvchange --resync first.Can't add additional mirror images to mirror %s which is under snapshots.%s is already being converted. Unable to start another conversion.Failed to insert resync layer.ABORTING: Failed to remove temporary mirror layer %s.Manual cleanup with vgcfgrestore and dmsetup may be required.--trackchanges is not available to 'mirror' segment type.--corelog and --mirrorlog are only compatible with mirror devices.Mirror segment type cannot be used for thinpool%s. Try "%s" segment type instead.Mirrors are not yet supported on cache LVs %s.Unable to split mirrors in VG with lock_type %sOnly up to %d images in mirror supported currently.Unable to reduce images by specified amount - only %d in %sAdjusting mirror image count of %sCopying region size %s from existing mirror.Mirror log region size cannot be changed on an existing mirror.Logical volume %s has multiple mirror segments.Cannot both allocate and free extents when specifying physical volumes to use.Please specify the operation in two steps.Logical volume %s being converted.Conversions to --type mirror require -m/--mirrorsUnknown operation on mirror LV %s.Unknown operation on raid LV %s.Unknown operation on striped or linear LV %s.Conversion using --type %s is not supported.--mirrorlog and --corelog are incompatible.--mirrors/--type mirror/--type raid* and --splitmirrors are mutually exclusive.Please name the new logical volume using '--name'Internal error: Changing conv_type from %d to %d.--stripes or --stripesize argument is only valid with --mirrors/--type mirror/--type raid*/--type striped/--type linear, --repair and --thinpool--chunksize is only available with snapshots or pools.--zero is only available with snapshots or pools.cannot be used with --type raid0 or --type striped or --type linearFailed to allocate poll identifier for lvconvert.Attempt to replace failed RAID images (requires full device resync)? [y/n]: Failed to replace faulty devices in %s.Faulty devices in %s successfully replaced.Use 'lvconvert --repair %s' to replace failed device.Mirror status: %d of %d images failed.Mirror log status: %d of %d images failed.Attempt to replace failed mirror log? [y/n]: Attempt to replace failed mirror images (requires full device resync)? [y/n]: WARNING: Trying to up-convert to %d images, %d logs.WARNING: Failed to replace %d of %d images in volume %s.WARNING: Failed to replace %d of %d logs in volume %s.WARNING: %d missing and now unallocated Physical Volumes removed from VG.Unsupported volume type for repair of volume %s.Volume %s is consistent. Nothing to repair.Failed to initialize processing handle.Internal error: Unknown pool conversion.Detaching writecache interrupted - locking VG failed.detach writecache check clean reading vg %sDetaching writecache interrupted - reading VG failed.Detaching writecache interrupted - reading VG error %x.Detaching writecache interrupted - LV not found.Detaching writecache interrupted - LV not active.Detaching writecache cleaning %llu blocksThis command can be cancelled and rerun to complete writecache detach.Detaching writecache completed cleaning.Detaching writecache cachevol failed.Removing the writecache cachevol failed.Logical volume %s write cache has been detached.lvconvert.c-i-otransaction="%s_meta%%dManual repair required._mimagetmp_%dlayer name creation failed.Failed to insert resync layerConversion aborted.WARNING: %s not zeroed.Metadata LV %s not found.Can't convert locked LV %s.pvmove_tmetaVolume %s replaced origin %s.Cannot activate %s.withWITHOUTMergedConvertedLogical volume %s not split.Unknown pool metadata LV %s.Creation of pool LV failed.Failed to lock pool LV %s.Converted %s to %s pool. and metadata volumes and Cache pool %s not found.Thin pool %s not found.LV does not have integrity.Device %s not found.PV %s not found in VG.%s_cache%s_cache%%dFailed to create cachevol LVLV %s is already in use.%s_cvolCannot find cache %s.Invalid writecache settings.Invalid cachevol LV./proc/meminfoMemTotal:%*s%llu%*sLV %s could not be zeroed._wcorigMerging of volume %s started.Setting logging type to %s.Logical volume %s converted.Cannot convert LV %s.No usable images left in %s.LVM_VG_NAMEvg/lv string alloc failed.Failed to remove temporary sync layer.Failed to swap %s with merging %s.Logical volume %s is no longer merging origin, polling has finished.Merge of snapshot into logical volume %s has finished.Could not remove snapshot %s merged into %s.%s: Failed query for merging percentage. Aborting merge.%s: Merging snapshot invalidated. Aborting merge.%s: Merge failed. Retry merge or inspect manually.lvconvert_poll.cpmove_tmeta%s: %s: %s%%LV %s is not merged.Inconsistent volume group names given: "%s" and "%s"Unable to create LV with unknown segment type %s.is unsupported with cache poolsCannot create read-only cache pool.Snapshot segment type is incompatible with thin pools.is unsupported with snapshots and --thinpoolSnapshot segment type requires size or extents.is supported only with sparse snapshotsis supported only with mirrorsPlease specify either size or pooldatasize.is supported only with thin pool creationThin segment type requires --virtualsize.Switching from thin to thin pool segment type.is unsupported with thin poolsCannot create read-only thin pool.is supported only with VDO pool creationis supported only with mirrors or raids--mirrors is supported only with mirrors or raidsis supported only with pools and snapshotsis supported only with vdo, sparse snapshots and thinsSegment type %s does not support --errorwhenfull.Please specify a logical volume to act as the cache pool or origin.Unsupported syntax, cannot use cache origin %s and --cachepool %s.The cache pool or cache origin name should include the volume group.Creation of cached volume and cache pool in one command is not yet supported.Please specify a logical volume to act as the snapshot origin.The origin name should include the volume group.Ambiguous %s name specified, %s and %s.The %s name should include the volume group.Please provide a volume group nameVolume group name expected (no slash)Logical volume name %s and pool name must be different.Volume group name %s has invalid charactersPlease specify either size or extents (not both).Please specify either size or extents.RAID10 currently supports only 2-way mirroring (i.e. '-m 1')--mirrors must be at least 1 with segment type %s.Redundant mirrors argument: default is 0Only up to %u stripes in %s supported currently.Only up to %u mirrors in %s supported currently.nosync option prohibited on RAID6.regionsize in configuration file is invalid.Please use only one of --corelog or --mirrorlog.Minimum of 2 stripes required for %s.Stripes argument cannot be used with segment type, %sMinimum of 3 stripes required for %s.Stripe size argument cannot be used with segment type, %sMirror argument cannot be used with segment type, %sAdjusting %s %s region size to required minimum of stripe size %s.Cannot use stripes with linear type.Conflicting contiguous and alloc arguments.Unable to allocate memory for tag %s.Segment type %s cannot use pool %s.Logical volume %s already exists in Volume group %s.Persistent major and minor numbers are unsupported with pools.Ambigous --readahead parameter specified. Please use either with pool or volume.Please specify name of existing pool.Pool %s not found in Volume group %s.Snapshot origin LV %s not found in Volume group %s.Thin pool volume %s not found in Volume group %s.Logical volume %s is not a thin pool volume.Please specify either size or extents with snapshots.Logical volume %s is not a thin volume. Thin snapshot supports only thin origins.Switching from snapshot to thin segment type.Change of volume permission is unsupported with cache conversion, use lvchange.is unsupported with cache conversionSkipping activation of cache origin %s.Cannot activate cache origin %s.Cannot deactivate activate cache origin %s.Ambiguous syntax, please create --type cache-pool %s separately.Unable to create RAID LV: requires minimum VG extent size %sUnable to create RAID(1)0 LV: insufficient number of devices.Segment type 'raid0' requires 2 or more stripes.Number of stripes must be at least %d for %sPlease either create snapshot or thin volume.Please specify device size(s).is only available when creating thin poolOnly specify Physical volumes when allocating thin pool.Please either create VDO or snapshot.Internal error: Buffer is too small for dm_snprintf().Cannot zero %slogical volume with option -Zy or -Wy.Ignoring option -Zy or -Wy for unzeroable %s volume.Please express size as %%FREE%s, %%PVS or %%VG.Internal error: Couldn't find origin volume.Calculated size of logical volume is 0 extents. Needs to be larger.Converted %u%% of %s (%u) extents into %u (with mimages %u and stripes %u for segtype %s).Internal error: Missing snapshot chunk size.Reducing COW size %s down to maximum usable size %s.Rounding size (%d extents) down to stripe boundary size (%d extents)Not enough space for thin pool creation.Adjusted size of logical volume is 0 extents. Needs to be larger.Internal error: --thinpool not identified.Internal error: Inconsistent snapshot and origin parameters identified.Internal error: Failed to identify what type of thin target to use.Making pool %s in VG %s using segtype %sNo space for sanlock lock, extend the internal lvmlock LV.Making thin LV %s in pool %s in VG %s%s%s using segtype %s.Use lvconvert to create thin pools and cache pools in a shared VG.Removal of created spare volume failed. Manual intervention required.Failed to find LV %s to add writecache.Removing new LV after failing to add writecache.Failed to deactivate new LV %s.Failed to find LV %s to add cache.Removing new LV after failing to add cache.lvcreate.cis unsupported with cacheis supported only with cacheis unsupported with snapshotsis unsupported with mirrorsis unsupported with raidsis supported only with raidsis unsupported with thinsis supported only with thinsis unsupported with VDOsmay not be negativemay not be zeroSetting logging type to %sUsing 2 stripes for %s.Using 3 stripes for %s.Setting chunksize to %s.Failed to get tag.is only available with poolsskipped from activation inactive auto activated read-only origin , %ORIGINwith generated name as snapshot of %s%s%s%s%s%s%sFailed to remove new LV %s.h[[ XZH]x[P[[XZ]`[Incompatible options selectedlvdisplay.cIncompatible options selected.Options -c and -m are incompatible.%s: no such command.lvmcmdline.c%s - %s -Unrecognised option %d (%c).Option requires argument.Invalid argument for %s: %s/proc/%u/cmdline/proc/self/fd/%u Parent PID %d: %s FFRSpecified %%%s is unknown.%s: invalid file descriptor.kmgtpebsSize is too big (>=16EiB).Can't parse size argument.stub.hOption %s %s.yesyyalnylSize may not be negative.Size may not be positive.Number may not be negative.Extents may not be negative.Extents may not be positive.wrRegion size may not be zero.pvsegpv_headerlabel_headerheadersmetadata_allmetadata_searchmetadata_areabackup_to_rawsystem ID: %sLVM version: %sLibrary version: %sDriver version: %sConfiguration: %sAvailable lvm commands:%-16.16s%sTZ:/etc/localtimeCouldn't copy command line.Version: %sParsing: %sCorrect command syntax is:Command requires options: %sIgnore opt %dInvalid devices file name.Invalid units specificationProcessing command: %sCommand pid: %dSystem ID: %sO_DIRECT will be usedskiplvskipvgskipglCompleted: %sLVM_LVMLOCKD_SOCKETToo many arguments: %squitexitlvm.staticinitrd-lvmstdin stream openstdin stream open: %s stdout stream openstderr stream open: %s LVM_OUT_FDLVM_ERR_FDLVM_REPORT_FDLVM_SUPPRESS_FD_WARNINGSRLIMIT_NOFILEgetrlimit/usr/sbin/lvmLVM_DID_EXECunsetenv-h-?Command definition index %d enum %d id %sInternal error: Command %s not found.Use --longhelp to show all options and advanced commands.Unable to allocate memory for command line arguments.Option%s%c%s%s may not be repeated.File descriptor %d (%s) leaked on %s invocation.Close failed on stray file descriptor %d (%s): %sWARNING: Running as a non-root user. Functionality may be unavailable.Percentage is too big (>=%d%%).Multiple sign symbols detected.Size requires number argument.Can't parse size argument at '%c'.%s%sSize is not a multiple of 512. Try using %lu or %lu.There's no 'lvmsadc' command in LVM2.Please use the superior 'dmstats' facilities instead.There's no 'lvmsar' command in LVM2.There's no 'pvdata' command in LVM2.Use lvs, pvs, vgs instead; or use vgcfgbackup and read the text file backup.There's no 'lvmchange' command in LVM2.Use 'dmsetup' commands to reset the kernel device-mapper driver.The vgconvert command has been removed along with the lvm1 format.Use a previous version of lvm to convert the lvm1 format to lvm2.%s and %s are synonyms. Please only supply one.Command profile '%s' requested via environment variable.Only one of --profile or --metadataprofile allowed.Only one of --profile or --commandprofile allowed.Size may not be relative/signed.Selected cache metadata format %d is not supported.Extents may not be relative/signed.Region size may not be negative.Region size is too big (max %u).Region size must be a multiple of machine memory page size (%d bytes).Region size must be a power of 2.Internal error: Failed to parse command definitions.Internal error: Failed to find command id %s../configure --build=x86_64-redhat-linux-gnu --host=x86_64-redhat-linux-gnu --program-prefix= --disable-dependency-tracking --prefix=/usr --exec-prefix=/usr --bindir=/usr/bin --sbindir=/usr/sbin --sysconfdir=/etc --datadir=/usr/share --includedir=/usr/include --libdir=/usr/lib64 --libexecdir=/usr/libexec --localstatedir=/var --sharedstatedir=/var/lib --mandir=/usr/share/man --infodir=/usr/share/info --with-default-dm-run-dir=/run --with-default-run-dir=/run/lvm --with-default-pid-dir=/run --with-default-locking-dir=/run/lock/lvm --with-usrlibdir=/usr/lib64 --enable-fsadm --enable-write_install --with-user= --with-group= --with-device-uid=0 --with-device-gid=6 --with-device-mode=0660 --enable-pkgconfig --enable-cmdlib --enable-dmeventd --enable-blkid_wiping --with-cluster=internal --enable-cmirrord --with-udevdir=/usr/lib/udev/rules.d --enable-udev_sync --with-thin=internal --with-cache=internal --enable-lvmpolld --enable-lvmlockd-dlm --enable-lvmlockd-dlmcontrol --enable-lvmlockd-sanlock --enable-dbus-service --enable-notify-dbus --enable-dmfilemapd --with-writecache=internal --with-vdo=internal --with-vdo-format=/usr/bin/vdoformat --with-integrity=internal --disable-silent-rulesUse 'lvm help ' for more informationFailed to strdup command basename.Error during parsing of command line.No command with matching syntax recognised. Run '%s --help' for more information.Nearest similar command has syntax:Command does not accept option: %s%s%s.Command does not accept argument: %s.Command does not accept option combination: %s with %sCommand does not accept options: %sRecognised command %s (id %d / enum %d).Updated config file invalid. Aborting.PARTIAL MODE. Incomplete logical volumes will be processed.--partial and --activationmode are mutually exclusive argumentsInvalid activation mode given.Ignoring unknown search_for_devnames setting, using %s.Failed to copy devices file name.A --devices list cannot be used with --devicesfile.DEGRADED MODE. Incomplete RAID LVs will be processed.%s: Command not permitted while global/metadata_read_only is set.WARNING: see lvmlockd(8) for information on using cluster/clvm VGs.WARNING: locking_type (%d) is deprecated, using --nolocking.WARNING: locking_type (%d) is deprecated, using --sysinit --readonly.WARNING: locking_type (%d) is deprecated, using file locking.WARNING: File locking is disabled.Ignoring unknown md_component_checks setting, using auto.Using md_component_checks %s use_full_md_check %dIgnore lvmlockd for pvscan cache.WARNING: skipping LV lock in lvmlockd.WARNING: skipping VG lock in lvmlockd.WARNING: skipping global lock in lvmlockd.Run `%s --help' for more information.Failed to read --devices args.Line too long (max 255) beginning: %sInternal error: Failed command did not use log_errorCommand failed with status code %d.Specify options after a command: lvm [command] [options].No such command. Try 'lvm help'.|l\L<, Ĭ/proc/self/fdFailed to apply %s %s.Setting global %s "%s".Failed to add %s %s.command profileGiving preference to command profile specified on command line over the one specified via environment variable.metadata profileLVM_COMMAND_PROFILEC`?`CAACDevices file not enabled.lvmdevices.cDevices file does not exist.No device found for %s.Invalid PVID.Found PVID %s on %s.Device not removed.No devices file entry for %s. PART=%dFailed to create the devices file.Checking filters with data for %sfilter result: %s in devices file is excluded by filter: %s.Not searching for missing devnames, search_for_devnames="none".Updated devices file to version %sNo update for devices file is needed.Updates needed for devices file.WARNING: adding device %s that is excluded: %s.PVID already exists in devices file for %s.Filtering devices (no data) for pvid searchFiltering devices (with data) for pvid searchPVID %s not found on any devices.WARNING: PVID %s found on %s which is excluded: %sDevice %s is used by an active LV, continue to remove? PVID not found in devices file.Multiple devices file entries for PVID %s (%s %s), remove by device name.Device %s IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s%-*s [%15s] %slvmdiskscan.cdev_iter_create failedCouldn't get size of "%s"LVM physical volume%d disk%s%d partition%s%d LVM physical volume%sWARNING: only considering LVM devices%d LVM physical volume whole disk%s--polloperation parameter is mandatoryArgument to --interval cannot be negativelvpoll.cProvide LV nameMovedUnknown polling operation %sPlease enter one or more logical volume paths or use --select for selection.lvremove.clvrename.cExisting logical volume "%s" not found in volume group "%s"Cannot rename a RAID %s directlyCannot rename %s while it is tracking a split imageExisting historical logical volume "%s" not found in volume group "%s"Renamed "%s%s" to "%s%s" in volume group "%s"Please use a single volume group name ("%s" or "%s")Old and new logical volume names requiredPlease provide a valid volume group nameLogical volume names must have the same volume group ("%s" or "%s")Old name references live LV while new name is for historical LV.New logical volume name "%s" may not exceed %zu characters.New logical volume name may not be blankNew logical volume name "%s" is invalidOld and new logical volume names must differLogical volume %s not found in volume group %s.Ignoring size parameters with --use-policies.Can't reduce pool metadata size.Please specify either size or extents but not both.Negative argument not permitted - use lvreduce.Positive sign not permitted - use lvextend.Please provide the logical volume name.Please specify a logical volume path.Mirrors argument may not be signed.Stripes argument may not be negative.Stripesize may not be negative.lvresize.cACTIVE OriginalSnapshot%s%s '%s%s/%s' [%s] %slvscan.cIgnoring lvscan --cache because lvmetad is no longer used.Failed to generate list of copied LVs: can't abort.ABORTING: Failed to generate list of copied LVsABORTING: Segment progression failed.Can't reread VG for %s error flags %x%s: No pvmove in progress - already finished or aborted.Can't find LV in %s for %s. Already finished or removed.%s: Interrupted: No longer active.Poll ID list allocation failed.Internal error: Wrong params for _copy_poll_operation_id.Failed to copy one or more poll_operation_id members.Internal error: Handle is undefined.Device name for LV %s not found in metadata. (unfinished pvmove mirror removal?)%s: Skipping inactive LV. Try lvchange or vgchange.Failed to create poll_id_list.ABORTING: Mirror percentage check failed.ABORTING: Polling interrupted for %s.ABORTING: Can't lock VG for %s.Can't find VG %s. No longer active.ABORTING: Can't reread VG for %s error flags %x.Argument to --interval cannot be negative.Checking progress %s waiting every %u seconds.devicefile name too long for lvmpolldpolldaemon.cMissing LV uuid within: %s/%sCan't find LV in %s for %s.afterResolve duplicate PV UUIDs with vgimportclone (or filters).Volume group containing %s does not support tagsVolume group containing %s has active logical volumesCan't change tag on Physical Volume %s not in volume groupCan't change PV '%s' without -ff.Allocatability not supported by orphan %s format PV %sPhysical volume "%s" is already allocatable.Physical volume "%s" is already unallocatable.Override preferred number of copies of VG %s metadata? [y/n]: Failed to generate new random UUID for %s.pv_write with new uuid failed for %s.Physical volume %s not changedFailed to set pvid for devices file.Failed to update devices file.Setting physical volume "%s" NOT allocatableSetting physical volume "%s" allocatablePlease give one or more of -x, -uuid, --addtag, --deltag or --metadataignorePlease give a physical volume path or use --select for selection.Option --all and PhysicalVolumePath are exclusive.%d physical volume%s changed / %d physical volume%s not changedpvchange.cChanging uuid of %s to %s. wrappedpvck.cprecommitwxFailed to create file %sid = seqno = description = creation_time = -- Skip writing in test mode.Failed to write new mda textmda_header.magicCHECK: no mem for printing %smda_header_%d.checksum 0x%xmda_header_%d.magic 0x%smda_header_%d.version %umda_header_%d.start %llumda_header_%d.size %llulabel_header at %llulabel_header.idlabel_header.id %slabel_header.sector %llulabel_header.crc 0x%xlabel_header.offset %ulabel_header.typelabel_header.type %sLABELONELVM2 001pv_header at %llupv_header.pv_uuidpv_header.pv_uuid %spv_header.device_size %llupv_header_extension at %llupv_header_extension.flags %uzero metadata copiesCHECK: second mda not foundNo lvm label found on device.No mda1 offset found.No mda2 offset found.Invalid metadata file.Write new LVM header to %s? Failed to write new headerFailed to set up device %s.Cannot use %s: %s.Cannot access %s. %63[^=]=%63s %nInvalid setting at: %smetadata_offsetbackup_filemda_offsetmda2_offsetmda2_sizedevice_sizemda_numInvalid setting: %sCannot open file: %sCannot access file: %sEmpty file: %sCannot read file: %s# GeneratedNo mda location.Unknown dump value.Write LVM header to device? Unknown repair value.mda_header_%d.raw_locn[%d] at %llu # %s%smda_header_%d.raw_locn[%d].offset %llumda_header_%d.raw_locn[%d].size %llumda_header_%d.raw_locn[%d].checksum 0x%xmda_header_%d.raw_locn[%d].flags 0x%x # RAW_LOCN_IGNOREDmda_header_%d.raw_locn[%d].flags 0x%xCHECK: mda_header_%d.raw_locn[%d] for precommit not emptyCHECK: mda_header_%d.raw_locn[%d].size larger than metadata area sizeskip invalid metadata with len %llu at %llumetadata at %llu length %llu crc %08x vg %s seqno %u id %sWARNING: parse error for metadata at %lluWARNING: unexpected terminating bytes for metadata at %lluWARNING: metadata from multiple VGs was found.Failed to extract full metadata text at %llu, skipping.CHECK: failed to read mda_header_%d at %lluWriting metadata at %llu length %llu crc 0x%08x mda%dWriting mda_header at %llu mda%dWrite new LVM metadata to %s? Failed to write new mda headerMetadata text %llu too large for mda_size %llu max %lluCHECK: failed to read mda_header at %llumda_header_%d at %llu # metadata areaCHECK: mda_header_%d.checksum expected 0x%xCHECK: mda_header_%d.magic expected 0x%sCHECK: mda_header_%d.version expected %uCHECK: mda_header_%d.start does not match pv_header.disk_locn.offset %lluCHECK: mda_header_%d.size does not match pv_header.disk_locn.size %lluCHECK: failed to read metadata area at offset %llu size %lluFailed to write file %s metadata area size %llu.CHECK: mda_header_%d.raw_locn[%d] no mem for metadata text size %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %llu part_a %llu %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %llu part_b %llu %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %lluCHECK: metadata text at %llu crc does not match mda_header_%d.raw_locn[%d].checksumCHECK: failed to set up metadata parsingCHECK: failed to parse metadata text at %llu size %llumetadata text at %llu crc 0x%x # vgname %s seqno %uCHECK: failed to read label_header at %lluCHECK: label_header.id expected %sCHECK: label_header.sector expected %dCHECK: label_header.crc expected 0x%xCHECK: label_header.offset expected 32CHECK: label_header.type expected %sCHECK: pv_header.pv_uuid invalid formatpv_header.disk_locn[%d] at %llu # location of data areapv_header.disk_locn[%d].offset %llupv_header.disk_locn[%d].size %llupv_header.disk_locn[%d] at %llu # location list endCHECK: problem with pv_header.disk_locn[%d] offset calculationpv_header.disk_locn[%d] at %llu # location of metadata areaWARNING: pv_header.disk_locn[%d].offset %llu is unexpected # for first mdapv_header_extension.version %upv_header_extension.disk_locn[%d] at %llu # bootloader areapv_header_extension.disk_locn[%d].offset %llupv_header_extension.disk_locn[%d].size %llupv_header_extension.disk_locn[%d] at %llu # location list endCHECK: problem with pv_header_extension offset calculationFound bad header or metadata values.Metadata input file is required.See --repairtype pv_header to repair headers.No metadata areas on device to repair.No metadata areas found on device.WARNING: Cannot get device size.WARNING: No LVM label found on %s. It may not be an LVM device.Skipping mda2 (wrong mda_header.version)Skipping mda2 (no matching VG UUID in metadata area)Skipping mda2 (wrong mda_header.start)Found mda2 header at offset %llu size %lluWARNING: PV will have no metadata with zero metadata areas.WARNING: no previous metadata areas found on device.Should a metadata area be included? To repair with zero metadata areas, use --settings "mda_offset=0 mda_size=0".mda2_offset setting %llu does not match mda2_offset found on disk %llu.mda2_size setting %llu does not match mda2_size found on disk %llu.Failed to read label_header at %lluWARNING: device_size setting %llu bytes does not match device size %llu bytes.Metadata input file is needed for pv_header info.See pvck --dump to locate and create a metadata file.WARNING: existing PV UUID %s does not match pv_uuid setting %s.PV UUID %s not found in metadata file.PV UUID %s in existing pv_header not found in metadata file.PV name %s not found in metadata file.No valid PV UUID, specify a PV UUID from metadata in --settings.Failed to scan devices to check PV UUID.Cannot use PV UUID %s which exists on %sWriting label_header.crc 0x%08x pv_header uuid %s device_size %lluWriting data_offset %llu mda1_offset %llu mda1_size %llu mda2_offset %llu mda2_size %lluFailed to parse UUID from pv_uuid setting.Invalid raw text metadata in file. File size is too small.Invalid raw text metadata in file.(pvck stdout is not valid input, see pvck -f.)(metadata backup file is not valid input.)WARNING: unexpected final bytes of raw metadata, expected \n\n\0.Invalid raw text metadata in file. (No VG UUID found.)WARNING: file data does not begin with a VG name and may be invalid.Write input file data to disk?Failed to read the first 4096 bytes of device %s.Specify at least two values from: mda_num, mda_offset, mda_size.Ignoring mda2 values from settings.Specify at least two values from: mda_num, mda2_offset, mda2_size.Invalid mda_num=1 and mda2 settings.Using common defaults for first mda: offset %llu size %llu.Override defaults with --settings "mda_offset= mda_size="Using defaults for second mda: offset %llu size %llu.Ignoring mda1_offset %llu mda1_size %llu from pv_header.Ignoring mda2_offset %llu mda2_size %llu from pv_header.Searching for metadata at offset %llu size %lluCHECK: mdas have different raw_locn[0].checksum valuesSet backup file in --settings backup_file=pathFile does not appear to contain a metadata backup.Writing label_header.crc 0x%08xFound label on %s, sector %llu, type=LVM2 001Found text metadata area: offset=%llu, size=%lluCould not find LVM label on %s--uuid is required with --restorefile--restorefile is required with --uuidCan only set uuid on one volume at oncePhysical volume size may not be negativeUnable to read volume group from %sCan't find uuid %s in backup file %spvcreate.cDevice "%s" has a capacity of %sPhysical volume "%s" of volume group "%s" is exported"%s" is a new physical volume of "%s"Option -c not allowed with option -mOption -c is not allowed with option -spvdisplay.cFailed to clone VG or LV name.--name takes a logical volume name.Named LV and old PV must be in the same VG.Incomplete LV name supplied with --name.Logical volume name %s is invalid.pvmove not allowed on raid LV with integrity.pvmove in a shared VG requires a named LV.pvmove not allowed on internal sanlock LV.pvmove in a shared VG requires exclusive lock on named LV.Detected pvmove in progress for %s.WARNING: Ignoring remaining command line arguments.ABORTING: Failed to generate list of moving LVs.ABORTING: Temporary mirror activation failed.No extents available for allocation.Creation of temporary pvmove LV failed.lvs_changed list struct allocation failed.Unable to pvmove when %s volume %s is present.Unable to pvmove device used for writecache.Unable to move device used for writecache cachevol %s.Unable to pvmove device used for raid with integrity.Internal error: LV name %s is too long.Can't find rimage or rmeta suffix.Can't find '_' after suffix %s.Raid sublv for name %s too long.Removing PV %s from trim list.Skipping LV %s which is not locally exclusive%s.Skipping LV %s which cannot be activated.Moving %u extents of logical volume %s.All data on source PV skipped. It contains locked, hidden or non-top level LVs only.Failed to convert pvmove LV to mirrored.Failed to split segments being moved.ABORTING: Temporary pvmove mirror activation failed. Run pvmove --abort.Internal error: Wrong params for _pvmove_create_id.Failed to allocate poll identifier for pvmove.Required device-mapper target(s) not detected in your kernel.Enable lvmpolld when using lvmlockd.Specify pvmove args when using lvmlockd.pvmove.cFailed to find an LV name.Logical volume %s not found.pvmove%dCan't find sub LV %s.Can't find PVs for sub LV %s.Skipping locked LV %s.No data to move for %s.Failed to allocate lvid.Failed to clone LV name.Internal error: %s is not a proper mirror imageInternal error: %s is not a pvmove mirror of LV-typeInternal error: Mirror image %u not found in segmentABORTING: Removal of temporary mirror failedABORTING: Unable to deactivate temporary logical volume %s.ABORTING: Removal of temporary pvmove LV failedWriting out final volume group after pvmoveABORTING: Failed to write new data locations to disk.pvmove_poll.cRemoving temporary pvmove LVPlease enter a physical volume pathWARNING: skipping global lock for force.pvremove.cInternal error: Invalid resize params.Please supply physical volume(s)%d physical volume(s) resized or updated / %d physical volume(s) not resizedpvresize.cpvscan.c%-*s with UUID %sInvalid PV name with uuid.PV %-*s %-*s %s [%s]/run/lvm/pvs_onlineCheck pv online: %sCheck pv online %s: yesCheck pv online %s: no/run/lvm/vgs_onlineCreate vg online: %sFailed to create %s: %dFailed to open %sNo info in %sNo device numbers in %svg:No vgname in %spvscan autoactivating VG %s.%s: autoactivation failed./run/lvm/pvs_lookupDid not create %s: %dwrite_lookup_file %s%d:%d vg:%s Create pv online: %s %d:%d %sWARNING: Failed to open %s.ignore lookup file line %sonline_devs %s %signore %s with no lvm info.pvscan[%d] PV %s not used.PV %s has no VG metadata.PV %s not found in VG %s.PV %s missing device size.ignore md component %s.PV %s ignore shared VG.PV %s ignore foreign VG.PV %s ignore exported VG.pvscan[%d] PV %s online.VG %s complete after recheck.PV %s online, VG unknown.VG unknownVG %s finishedLVM_VG_NAME_COMPLETE='%s' VG %s completeLVM_VG_NAME_INCOMPLETE='%s' VG %s incompleteFailed to find LVs using %s.LV %s completeFailed to check partial lvs.LV %s incompleteof exported volume group(s)in no volume groupUnlink vg online: %sRemove pv online devno %d:%dUnlink pv online %sUnlink pvs_lookup: %sLVM_EVENT_ACTIVATION=0/run/lvmCreating run_dir.Creating pvs_online_dir.Creating vgs_online_dir.Creating pvs_lookup_dir.pvscan[%d] %s excluded: %s.%s cannot read label.%s not an lvm device.No VGs to autoactivate.VG %s skip autoactivation.VG %s run autoactivation.autoactivate quickautoactivate slowPV %-*s is in exported VG %s [%s / %s free]PV %-*s VG %-*s %s [%s / %s free]Internal error: Path %s/%s is too long.pvscan[%d] Path %s/%s is too long.pvscan[%d] %s: autoactivation failed.Cannot create online file path for %s %d:%d.pvscan[%d] Cannot create online file path for %s %d:%d.Incomplete online file for %s %d:%d vg %s.pvscan[%d] Incomplete online file for %s %d:%d vg %s.Failed to create online file for %s path %s error %dpvscan[%d] Failed to create online file for %s path %s error %dCannot write online file for %s to %s error %dExisting online file for %d:%dPV %s is duplicate for PVID %s on %d:%d and %d:%d.pvscan[%d] PV %s is duplicate for PVID %s on %d:%d and %d:%d.PV %s has unexpected VG %s vs %s.pvscan[%d] PV %s has unexpected VG %s vs %s.set_pv_devices_online vg %s pv %s missing flag already setset_pv_devices_online vg %s pv %s no online fileWARNING: VG %s PV %s wrong vgname in online file %sVG %s PV %s no device found for %d:%dpvscan[%d] VG %s PV %s no device found for %d:%dset_pv_devices_online vg %s pv %s is online %sWrong VG found for %d:%d PVID %s: %s vs %spvscan[%d] Wrong VG found for %d:%d PVID %s: %s vs %sNo device found for %d:%d PVID %spvscan[%d] No device found for %d:%d PVID %sPVID %s read from %s last written to %s.pvscan[%d] PVID %s read from %s last written to %s.pvscan using %s for PVID %s in VG %sWARNING: Path %s/%s is too long.checking all pvid files using lookup file for %sWARNING: Failed to strdup vgname.pvscan[%d] ignore %s with no lvm info.pvscan[%d] failed to create format instance.pvscan[%d] PV %s has no VG metadata.pvscan[%d] PV %s not found in VG %s.pvscan[%d] PV %s missing device size.pvscan[%d] ignore md component %s.pvscan[%d] PV %s ignore shared VG.Ignore PV %s with VG system id %s with our system id %spvscan[%d] PV %s ignore foreign VG.pvscan[%d] PV %s ignore exported VG.PV %s failed to create online file.pvscan[%d] PV %s failed to create online file.checking all pvid files from vg %srechecking all pvid files from vg %spvscan[%d] VG %s complete after recheck.checking all pvid files from lookup filepvscan[%d] PV %s online, VG unknown.PV %s online, VG %s incomplete (need %d).pvscan[%d] PV %s online, VG %s incomplete (need %d).PV %s online, VG %s is complete.pvscan[%d] PV %s online, VG %s is complete.Cannot list LVs from device without metadata.pvscan[%d] Cannot list LVs from device without metadata.pvscan[%d] Failed to find LVs using %s.pvscan[%d] Failed to check partial lvs.Options -e and -n are incompatibleWARNING: only considering physical volumes %sNo matching physical volumes foundTotal: %d [%s] / in use: %d [%s] / in no VG: %d [%s]Ignoring pvscan --cache -aay because event_activation is disabled.Ignoring pvscan with --checkcomplete because event_activation is disabled.pvscan[%d] Ignoring pvscan with --checkcomplete because event_activation is disabled.Both --major and --minor required to identify devices.pvscan[%d] Failed to create %s %dpvscan_cache_all: label scan allpvscan_cache_all: create list of devicesIgnoring pvscan --cache because event_activation is disabled.pvscan[%d] Failed to set up devices.WARNING: Failed to parse major:minor from %s, skipping.pvscan_cache_args: filter devs nodatapvscan_cache_args: read and filter devspvscan[%d] %s cannot read label.pvscan[%d] %s not an lvm device.%s excluded by devices file (checking PVID).pvscan[%d] %s excluded by devices file (checking PVID).pvscan_cache_args: label scan devspvscan[%d] Failed to initialize processing handle.pvscan[%d] VG %s skip autoactivation.pvscan[%d] VG %s run autoactivation.VG %s not using quick activation.pvscan[%d] VG %s not using quick activation.activation for VG %s failed to lock VG.pvscan[%d] activation for VG %s failed to lock VG.activation for VG %s failed to find vgid.pvscan[%d] activation for VG %s failed to find vgid.activation for VG %s cannot read (%x).pvscan[%d] activation for VG %s cannot read (%x).activation for VG %s found different devices.pvscan[%d] activation for VG %s found different devices.reporter.c in VG subreport_optionsInvalid options string: %s%s: unknown report format.Failed to create log report.No log report stored.Unknonwn report specifier in report option list: %s.Can't report LV and PV fields at the same time in %sreport type "%s"%s%s.Subreport of type "%s" for VG %s contains columns which lead to change of report type. Add these columns to proper subreport type.Merge is in progress, reporting merged LV %s.Internal error: _report_all_in_vg: incorrect report typeInternal error: _set_report_prefix_and_name: no prefix found for report type 0x%x_set_report_prefix_and_name: dm_strncpy failedInternal error: _report: unknown report type.Failed to create temporary mempool to process report options.WARNING: devtypes currently ignores command line arguments.Internal error: _do_report: full report requested at incorrect levelInternal error: _do_report: unknown report type.Failed to compact report output.Failed to compact given columns in report output.Failed to add main report section to report group.Failed to finalize main report section in report group.Internal error: _report_all_in_lv: incorrect report typeInternal error: _report_all_in_pv: incorrect report typeInternal error: report_for_selection: incorrect report typeSupported report formats: %s, %s.Failed to create report group.Failed to add log report to report group.Failed to set log report name for command context.Failed to set selection for log report.use_toollib.cunknown Skipping volume group %s%s fork failed: %sredirect(lvm2)Allocation of vg_name failed.lock_type %s is invalidSetting lock_type to %sDisabling%s pool zeroing.Setting pool discards to %s.Using default stripesize %s.Unknown VDO setting "%s".successInterrupted.Failed to find device "%s".dev_iter creation failed.Selection failed for VG %s.Selection failed for LV %s.Selection failed for PV %s.Processing each VGstrlist allocation failed.Skipping invalid tag: %sInvalid volume group name %s.No volume groups found.Processing VG %s %sRunning command for VG %s %sProcessing LV %s in VG %s.positionProcessing each PVdevice_id_list alloc failed.Cannot use %s: %sProcessing PVs in VG %sProcessing PV %s in VG %s.Skipping PV %s in VG %s.Processing device %s.strdup failed.No PV found on device %s.Can't get device size of %s.No devices to process.Failed to rescan devs exclChecking %s to confirm %.32s.Check confirm arg %s no info.Cannot read orphans VG %s.alloc pvl failed.Creating a new PV on %s.Zeroing start of device %s.%s not wiped: aborting.%s: command failed for %s.Using existing orphan PV %s.Failed to find PV %sMultiple VGs found with the same name: skipping %sUse --select vg_uuid= in place of the VG name.Processing VG %s because of matching UUID %sVG name on command line not found in list of VGs: %sCannot access clustered VG %s.See lvmlockd(8) for changing a clvm/clustered VG to a shared VG.Skipping exported volume group %sCannot access VG %s with system ID %s with %slocal system ID%s%s.Skipping foreign volume group %sCannot process standalone physical volumesCannot process volume group %sCan't initialize PV '%s' without -ff.Can't initialize physical volume "%s" of volume group "%s" without -ffUnable to add physical volume '%s' to volume group '%s'Really INITIALIZE physical volume "%s" of volume group "%s" [y/n]? WARNING: Forcing physical volume creation on %s of volume group "%s"WARNING: Faking size of PV %s. Don't write outside real device.WARNING: %s: device size %s does not match requested size %s. Proceed? [y/n]: PV %s is used by VG %s so please use vgreduce first.(If you are certain you need pvremove, then confirm by using --force twice.)WARNING: PV %s is used by VG %s.Really WIPE LABELS from physical volume "%s" of volume group "%s" [y/n]? WARNING: prompt answer yes is overridden by prompt answer no.%s: physical volume not initialized.%s: physical volume label not removed.WARNING: Wiping physical volume label from %s of volume group "%s".Forking background process from command: %sWARNING: Failed to set SIGCHLD action.Failed to sync local devices before forking.Background process failed to setsid: %sskip_dev_dir: Couldn't split up device name %s."%s": Invalid path for Logical Volume."%s": Invalid environment var LVM_VG_NAME set for Volume Group.Path required for Logical Volume "%s".The clustered option is deprecated, see --shared.Physical extent size must be smaller than %s.Max Logical Volumes may not be negative.Max Physical Volumes may not be negative.VG with system ID %s might become inaccessible as local system ID is %sWARNING: A VG without a system ID allows unsafe access from other hosts.The --shared option requires lock type sanlock, dlm or idm.Found multiple lock managers, select one with --lock-type.Failed to detect a running lock manager to select lock type.Using a shared lock type requires lvmlockd (lvm.conf use_lvmlockd.)Using a shared lock type requires lvmlockd.Skipping activation of cache pool %s.Skipping deactivation of used cache pool %s.Refusing to activate merging volume %s while snapshot volume %s is still active.Cannot fully deactivate merging origin volume %s while snapshot volume %s is still active.Cannot activate LVs in VG %s while PVs appear on duplicate devices.Cannot activate uninitialized integrity LV %s from pvscan.Cannot activate uninitialized integrity LV %s without lock.Updating VG to complete initialization of integrity LV %s.Spawning background pvmove process for %s.Spawning background lvconvert process for %s.Delaying merge for origin volume %s since snapshot volume %s is still active.--ignoremonitoring or --sysinit option not allowed with --monitor option.Setting pool chunk size to %s.Please specify either metadata logical volume or its size.Negative stripesize is invalid.Number of stripes (%d) must be between %d and %d.Ignoring stripesize argument for %s devices.Ignoring stripesize argument with single stripe.Cache mode "writeback" is not compatible with cache policy "cleaner".Invalid argument for VDO setting "vdo_%s".Cannot change VDO setting "vdo_%s" in existing VDO pool.Setting fua and nofua cannot both be set.Setting %s is not recognized. Only one unrecognized setting is allowed.Unrecognized writecache setting "%s" may cause activation failure.Use unrecognized writecache setting? [y/n]: Aborting writecache conversion.Using unrecognized writecache setting: %s = %s.High watermark must be greater than low watermark.Failed to add tag %s to physical volume %s.No physical volume label read from %s.Option --minor may not be repeated.Option -j|--major may not be repeated.Options --major and --minor are incompatible with -Mn.Please specify minor number with --minor when using -My.Please specify major number with --major when using -My.WARNING: Ignoring supplied major number %d - kernel assigns major numbers dynamically. Using major number %d instead.Please use a single volume group name ("%s" or "%s").Logical volume name "%s" is invalid._init_processing_handle: failed to allocate memory for processing handle_init_selection_handle: failed to allocate memory for selection handleObtaining the complete list of VGs to processIgnoring virtual origin logical volume %s.Adding %s to the list of LVs to be processed.Failed to allocate final LV list item.Internal error: Command %d:%s arg position %d does not permit an LV (%llx)Command on LV %s does not accept LV type unknown (%d).Command on LV %s does not accept LV type %s.Command not permitted on LV %s.Command on LV %s has invalid use of option %s.Command on LV %s requires option %s.Command on LV %s uses options invalid with LV type %s.Command on LV %s with invalid LV type %s.Command on LV %s uses options that require LV types %s.Command on LV %s does not accept LV type %s. Required LV types are %s.Command on LV %s uses options that are invalid with LV properties: %s.Command on LV %s is invalid on LV with properties: %s.Command on LV %s uses options that require LV properties: %s.Command on LV %s requires LV with properties: %s.Processing historical LV %s in VG %s.Failed to find logical volume "%s/%s"Processing lockd_sanlock_lv %s/%s.One LV position arg is required.VG name mismatch from %s arg (%s) and option arg (%s).Cannot find VG name for LV %s.Obtaining the complete list of VGs before processing their LVsTags cannot be used with this command.Cannot use PV %s in exported VG %s.Cannot use PV %s in foreign VG %s.Cannot use PV %s in shared VG %s.Processing duplicate device %s.Internal error: No info for pvidFailed to find physical volume "%s".Processing devices that are not PVslabelsector must be less than %lu.metadataignore only applies to metadatacopies > 0.Physical volume data alignment may not be negative.Physical volume data alignment is too big.Physical volume data alignment offset may not be negative.Physical volume data alignment offset is too big.WARNING: Ignoring data alignment %s incompatible with restored pe_start value %s.Metadata size may not be negative.Bootloader area size may not be negative.Scanning and filtering device args (%u).Command requires all devices to be found.WARNING: Unknown block size for device %s.WARNING: Unknown logical_block_size for device %s.WARNING: Devices have inconsistent physical block sizes (%u and %u).See lvm.conf allow_mixed_block_sizes.Checking %s for pvremove %.32s.Check pvremove arg %s no PVID foundCheck pvremove arg %s device is not a PV.Check pvremove arg %s found vg %s.Check pvremove arg %s found EXT_USED flag.Check pvremove arg %s is orphan.Checking %s for pvcreate %.32s.Check pvcreate arg %s no PVID foundCannot use device %s with duplicates.Failed to read lvm info for %s PVID %s.Check pvcreate arg %s found vg %s.Check pvcreate arg %s found EXT_USED flag.Check pvcreate arg %s is orphan.UUID %s already in use on "%s".Check pvremove arg %s device is a duplicate.Failed to reacquire global lock after prompt.Rescanning and filtering device args with exclusive openCheck confirm arg %s no PVID foundCannot use device %s: it changed during prompt.Wiping signatures on new PV %s.Using existing orphan PVs in %s.Failed to wipe existing label on %s.Writing physical volume data to disk "%s".Failed to write physical volume "%s".Physical volume "%s" successfully created.Failed to wipe existing label(s) on %s.Labels on physical volume "%s" successfully wiped. 0Ib{/Ck""%5N|)BZs \/dev/nullPhysical extent size may not be negative.Failed to allocate filename.vgcfgbackup.cError processing filename template %sVGs must be backed up into different files. Use %%s in filename for VG name.No backup taken: specify filename with -f to backup with missing PVs.No backup taken: specify filename with -f to backup with unknown segments.Volume group "%s" successfully backed up.vgcfgrestore.cNo devices found.Restore aborted.Restore failed.Restored volume group %s.Volume group %s has active volume: %s.Volume group name "%s" is invalid.Please specify a *single* volume group to restore.Internal error: VG name is not set.WARNING: Failed to check for active volumes in volume group "%s".WARNING: Found %u active volume(s) in volume group "%s".Restoring VG with active LVs, may cause mismatch with its metadata.Do you really want to proceed with restore of volume group "%s", while %u volume(s) are active? [y/n]: Unable to lock volume group %s.vgchange.c(no profile)Failed to deativate %s.Unable to set system ID.DeaRefreshing volume group "%s"No volume groups changed.VG lock type not changed.No global lock for lock startautonowaitVolume group autoactivation is already %s.Changing configuration profile for VG %s: %s -> %s.vgchange_metadata_copies new %u vg_mda_copies %u D %uNumber of metadata copies for VG %s is already unmanaged.Number of metadata copies for VG %s is already %u.Volume group "%s" is already resizeableVolume group "%s" is already not resizeableVolume group allocation policy is already %sVolume group has active logical volumesFailed to generate new random UUID for VG %s.Physical extent size cannot be larger than %s.Physical extent size of VG %s is already %s.Failed to change physical extent size for VG %s.New lock type %s matches the current lock type %s.Cannot change lock type directly from "%s" to "%s".First change lock type to "none", then to "%s".Changing VG %s lock type not allowed with active LVsFailed to initialize lock args for lock type %sCannot change to unknown lock type %sVolume group "%s" successfully changedIgnoring invalid string in lock_start listIgnoring empty string in config fileNot starting %s since it does not pass lock_start_listNot starting %s since it does not pass auto_lock_start_listVolume Group system ID is already "%s".WARNING: Removing the system ID allows unsafe access from other hosts.Remove system ID %s from volume group %s? [y/n]: System ID of volume group %s not changed.Logical Volumes in VG %s must be deactivated before system ID can be changed.WARNING: Requested system ID %s does not match local system ID %s.WARNING: No local system ID is set.WARNING: Volume group %s might become inaccessible from this machine.Set foreign system ID %s on volume group %s? [y/n]: Volume group %s system ID not changed.Changing system ID for VG %s from "%s" to "%s".Starting background polling for volume group "%s".Background polling started for %d logical volume(s) in volume group "%s"Autoactivation is disabled for VG %s.Can't deactivate volume group "%s" with %d open logical volume(s)%d logical volume(s) in volume group "%s" already active%d existing logical volume(s) in volume group "%s" %smonitored%sctivated %d logical volumes in volume group %s.Failed to sync local devices for VG %s.%d logical volume(s) in volume group "%s" now active%d logical volume(s) in volume group "%s" %smonitoredNeed one or more command options.Only one of --metadataprofile and --detachprofile permitted.Only one of -a and --refresh permitted.Only -a permitted with --ignorelockingfailure and --sysinitOnly -ay* allowed with --monitor or --poll.Only one of --poll and --sysinit permitted.MaxPhysicalVolumes may not be negativePhysical extent size may not be negativeChange clustered property of all volumes groups? [y/n]: Lock type can only be forced to "none" for recovery.Forcibly change VG lock type to none? [y/n]: Using lock type requires lvmlockd.Using lock start and lock stop requires lvmlockd.Starting locking. Waiting for sanlock may take 20 sec to 3 min...Starting locking. Waiting until locks are ready...Starting locking. VG can only be read until locks are ready.vgck.cFailed to write VG.Failed to commit VG.The volume group is missing %d physical volumes. with system ID vgcreate.cFailed to get tagFailed to start lockingPlease provide volume group name and physical volumesA volume group called %s already exists.WARNING: Setting maxlogicalvolumes to %d (0 means unlimited)WARNING: Setting maxphysicalvolumes to %d (0 means unlimited)Volume group "%s" successfully created%s%sStarting locking. VG is read-only until locks are ready.--- Physical volumes ---vgdisplay.cOption -A is not allowed with volume group namesVolume group "%s" has active logical volumesLV %s/%s must be inactive on all hosts before vgexport.Volume group "%s" successfully exportedPlease supply volume groups or use --select for selection or use -a for all.No arguments permitted when using -a for all.vgexport.cVolume group "%s" will be extended by %d new physical volumesVolume group "%s" successfully extendedWARNING: PV %s not found in VG %sWARNING: The PV %s is still missing.WARNING: PV %s was not missing in VG %sPlease enter volume group name and physical volume(s)Volume group %s not changedvgextend.cNo PV has been restored.Volume group "%s" is not exportedVolume group "%s" is partially missingVolume group "%s" successfully importedPlease supply volume groups or -S for selection or use -a for all.WARNING: Volume groups with missing PVs will be imported with --force.vgimport.cvgimportclone.cFailed to find device %s.scan new devsDevice %s is excluded: %s.No VG found on devices.get other devicesscan other devicesBase vg name %s is too long.%s1%s%uUsing new VG name %s.import vg on new devicesCan't get lock for VG name %sVG is missing a device.Failed to write devices file.Devices file not enabled, ignoring importdevices.Devices file does not exist, ignoring importdevices.Failed to find PVID for device %s.Devices must be from the same VG.Internal error: Old vg name %s is too long.Temporary vg name %s1 is too long.Failed to generated temporary vg name, %s%u is too long.Can't get lock for new VG name %sFailed to read VG %s from devices being imported.Error reading VG %s from devices being imported.VG %s is exported, use the --import option.VG %s is partial, it must be complete.Device %s has active LVs, deactivate first.PV with UUID %s is part of VG %s, but is not included in the devices to import.All PVs in the VG must be imported together.Device %s was not found in VG %s.The devices to import must match the devices in the VG.Failed to add device id for %s.Failed to update VG on devices being imported.Not importing devices for VG %s with missing PV %s.Failed to write device ids in VG metadata.Failed to set up devices file.Failed to create devices file.Failed to write the devices file.Added %u devices to devices file.vgimportdevices.cNo devices to add.Checking for volume group "%s"vgmerge not allowed for lock_type %sPlease enter 2 or more volume groups to mergeDuplicate volume group name "%s"Removing pool metadata spare %s.Failed to generate new random LVID for %sWriting out updated volume groupVolume group "%s" successfully merged into "%s"vgmerge.cChanged LVID for %s to %svgmknodes.cWARNING: Partial LV %s needs to be repaired or removed. There are still partial LVs in VG %s.To remove them unconditionally use: vgreduce --removemissing --force.To remove them unconditionally from mirror LVs use: vgreduce --removemissing --mirrorsonly --force.WARNING: Proceeding to remove empty missing PVs.Volume Groups must always contain at least one PV.Removing PV with UUID %s from VG %s.LVs still present on PV with UUID %s: Can't remove from VG %s.Non-mirror-image LV %s found: can't remove.WARNING: Removing partial LV %s.Failed to write out a consistent VG for %sPlease give volume group name and physical volume paths.Please give volume group name.--mirrorsonly requires --removemissing.Please enter physical volume paths or option -a.Option -a and physical volume paths mutually exclusive.Please only specify the volume group.Volume group "%s" is already consistent.Wrote out consistent volume group %s.vgreduce.cWARNING: %d physical volumes are currently missing from the system.Do you really want to remove volume group "%s" containing %u logical volumes? [y/n]: Please enter one or more volume group paths or use --select for selection.vgremove.cVolume group "%s" not removedCan't get lock for %svgrename.cRenaming "%s" to "%s"Test mode: Skipping rename.Renaming "%s" to "%s" failedNew VG name must differ from the old VG name.New VG name "%s" already existsNew VG name "%s" matches the UUID of existing VG %sRenaming path is too long %s/%s %s/%sVolume group "%s" successfully renamed to "%s"Old and new volume group names need specifyingexported vgscan.cFound %svolume group "%s" using metadata type %sCannot notify dbus: lvm is not built with dbus support.Cannot notify dbus: notify_dbus is disabled in lvm config.Ignoring vgscan --cache command because lvmetad is no longer used.Logical volume %s (part of %s) must be inactive.Logical volume %s must be inactive.Can't split LV %s between two Volume GroupsExisting VG, new VG and either physical volumes or logical volume required.A logical volume name cannot be given with physical volumes.Failed to lock new VG name %s.Volume group "%s" exists, but new VG option specifiedCan't split Logical Volume %s between two Volume GroupsCan't split mirror %s between two Volume GroupsCan't split external origin %s and pool %s between two Volume Groups.Can't split pool data and metadata %s between two Volume Groups.Cannot split cache origin %s and its cache pool data %s into separate VGs.Cannot split cache origin %s and its cache pool metadata %s into separate VGs.Cannot split cache pool data %s and its metadata %s into separate VGs.Cannot split cache origin %s and its cachevol %s into separate VGs.Can't split snapshot %s between two Volume GroupsCannot split: Nowhere to store metadata for new Volume GroupWriting out updated volume groupsVolume group "%s" became inconsistent: please fix manually%s volume group "%s" successfully split from "%s"vgsplit.cExistingNewInvalid vg name %s.Failed to create new VG %s.Failed to read VG %s.Physical Volume %s not foundHandle initialisation failed.lvmcmdlib.cCmdline copy failed.No command supplied_memlock_inc_memlock_dec_dmeventd_thin_command_dmeventd_vdo_commandToo many arguments. Limit is %d.config-util.cFailed to duplicate node key.%t%.*s= %ld %.*s= "%s" %b%.*s%sInternal error: Bad format string '%s'Internal error: Bad format string at '%s'Internal error: Do not use %%d and use correct 64bit form end %dInternal error: Message response doesn't contain terminating NUL characterFailed to mangle new device UUID "%s"New device uuid mangled [%s]: %s --> %sdm_task_set_newuuid: strdup(%s) faileddm_task_set_message: strdup faileddm_task_set_geometry: sprintf failedTarget type name %s is too long.create_target: malloc(%zu) failedcreate_target: strdup(params) failedcreate_target: strdup(type) failedInternal error: unknown device-mapper task %dFailed to revert device creation.Failed to create device-mapper task structreload %u:%u diff start %llu %llu type %s %sreload %u:%u diff length %llu %llu type %s %sreload %u:%u diff params ignore for type %sreload %u:%u diff params for type %sInternal error: Performing unsafe table load while %d device(s) are known to be suspended: %s%s%s %s%.0d%s%.0d%s%sInternal error: dm '%s' ioctl should not define parameters.targets and message are incompatibletargets and rename are incompatibletargets and geometry are incompatiblemessage and rename are incompatiblegeometry and rename are incompatiblegeometry and message are incompatiblemessage is required with sectorOverriding major number of %d with %u for persistent device.Missing major number for persistent device.device (%u:%u) is %s for compatibility with old kernelUnable to find name for device (%u:%u)No flush flag unsupported by kernel. Buffers will be flushed.Secure data flag unsupported by kernel. Buffers will not be wiped after use.WARNING: Inactive table query unsupported by kernel. It will use live table.WARNING: Setting UUID unsupported by kernel. Aborting operation.WARNING: IMA measurement unsupported by kernel. Aborting operation.Ran out of memory building ioctl parameterCouldn't create ioctl argument.Cookie value is not set while trying to call %s ioctl. Please, consider using libdevmapper's udev synchronisation interface or disable it explicitly by calling dm_udev_set_sync_support(0).Switching off device-mapper and all subsystem related udev rules. Falling back to libdevmapper node creation.dm %s %s%s %s%s%s %s%.0d%s%.0d%s%s[ %s%s%s%s%s%s%s%s%s%s] %.0lu %s [%u] (*%u)device-mapper: %s ioctl on %s %s%s%.0d%s%.0d%s%s failed: %sUevent not generated! Calling udev_complete internally to avoid process lock-up.WARNING: libdevmapper buffer too small for dataAttempting to suspend a device that is already suspended (%u:%u)Internal error: Attempt to suspend device %s%s%s%.0d%s%.0d%s%sthat uses already-suspended device (%u:%u)Failed to get device-mapper versionIncompatible libdevmapper %s%s and kernel driver %s.Hold of control device is now %sset.libdevmapper exiting with %d device(s) still suspended._НННННȭН^^^НН [trust_udev] [verify_udev]device_mapper/libdm-common.c%s: %s NODE_DEL%s%s%s: %s NODE_RENAME to %s%s%sDM_DEBUG_WITH_LINE_NUMBERS%s:%d #+-.:=@_selabel_open failed: %sFailed to build sysfs_path.%s/block/bdiqueueuremovableslavetraceuevent%sblock/%s/%s/devsemid %d: semctl failed: %sUnstackingStackingDM_DEFAULT_NAME_MANGLING_MODE1.02.181-RHEL8 (2021-10-20)\x5cx\x%02xName "%s" too long.Couldn't create path for %sDevice %s not found%s/../%s%2x%sName "%s" too longSELinux context resetsetfscreateconlsetfilecon%s (%d:%d): read ahead is %uBLKRAGET%s: read ahead is %uNew uuid prefix %s too long.%*u %*u %u:%u %4096s %4096s%sdev/block/%u:%u/dm/name%sdev/block/%u:%u%sdev/block/%u:%u/holders%sfs%sfs/%s/%sFailed to get driver versionDM udev checking enabledDM udev checking disabled%s: mknod for %s failed: %schownCreated %sRemoved %sRenamed %s to %sProcessingFailed to build size in kB.BLKRASETSkipping SUBSYSTEM_7 SUBSYSTEM_6 SUBSYSTEM_5 SUBSYSTEM_4 SUBSYSTEM_3 SUBSYSTEM_2 SUBSYSTEM_1 SUBSYSTEM_0 PRIMARY_SOURCE DISABLE_LIBRARY_FALLBACK LOW_PRIORITY DISABLE_OTHER_RULES DISABLE_DISK_RULES DISABLE_SUBSYSTEM_RULES DISABLE_DM_RULESCREATERELOADREMOVE_ALLINFODEPSWAITEVENTLISTCLEARMKNODESLIST_VERSIONSTARGET_MSGSET_GEOMETRY%s: %s NODE_ADD (%u,%u) %u:%u 0%o%s%s%s: %s NODE_READ_AHEAD %u (flags=%u)%s%sselabel_lookup failed for %s: %sCouldn't create path for %s/%s.semid %d: sem_ctl GETVAL failed for cookie 0x%x: %ssemid %d: semop failed for cookie 0x%x: incorrect semaphore statesemid %d: semop failed for cookie 0x%x: %sUdev cookie 0x%x (semid %d) decremented to %dCould not cleanup notification semaphore identified by cookie value %u (0x%x): %sUdev cookie 0x%x (semid %d) destroyedFailed to open /dev/urandom to create random cookie valueFailed to initialize notification cookieNot enough memory to create notification semaphoreLimit for the maximum number of semaphores reached. You can check and set the limits in /proc/sys/kernel/sem.Failed to create notification semaphore: %sUdev cookie 0x%x (semid %d) createdUdev cookie 0x%x (semid %d) incremented to %dKernel not configured for semaphores (System V IPC). Not using udev synchronisation code.Udev is not running. Not using udev synchronisation code.Could not get udev state. Assuming udev is not running.Udev is running and DM_DISABLE_UDEV environment variable is set. Bypassing udev, device-mapper library will manage device nodes in device directory.Could not continue to access notification semaphore identified by cookie value %u (0x%x). Incorrect cookie prefix.Could not find notification semaphore identified by cookie value %u (0x%x)No permission to access notificaton semaphore identified by cookie value %u (0x%x)Failed to access notification semaphore identified by cookie value %u (0x%x): %sInvalid directory value, %s: not an absolute name.Invalid directory value, %s: name too long.Failed to build dev path for "%s".Insufficient memory to stack mknod operationSuspended device counter increased to %dAttempted to decrement suspended device counter below zero.Suspended device counter reduced to %ddm_task_create: malloc(%zu) failedThe %s "%s" seems to be mangled more than once. This is not allowed in auto mode.Internal error: mangle_string: supplied buffer too smallThe %s "%s" contains mixed mangled and unmangled characters or it's already mangled improperly.Mangled form of the %s too long for "%s".Failed to mangle device name "%s".Device name mangled [%s]: %s --> %s_dm_task_set_name: strdup(%s) failedName "%s" invalid. It contains "/".Couldn't create /dev path for %s_task_get_string_mangled: strdup failedInternal error: unmangle_string: supplied buffer too smallThe %s "%s" should be mangled but it contains blacklisted characters.Hex encoding mismatch detected in %s "%s" while trying to unmangle it._task_get_string_unmangled: strdup failedFailed to unmangle device name "%s".Failed to mangle device uuid "%s".Failed to unmangle device uuid "%s".Non empty new name is required.Failed to mangle new device name "%s"New device name mangled [%s]: %s --> %sdm_task_set_newname: strdup(%s) failedDevice uuid mangled [%s]: %s --> %sdm_task_set_uuid: strdup(%s) failedPreparing SELinux context for %s to %s.Resetting SELinux context to default value.Setting SELinux context for %s to %s.%sdev/block/%u:%u/bdi/read_ahead_kbEmpty device name passed to BLKRAGETFailed to parse mountinfo line.Mount info task creation failed.Replacing mountinfo device (%u:%u) with matching DM device %s (%u:%u)._sysfs_get_dm_name: failed to allocate temporary buffers_sysfs_get_dm_name: dm_snprintf failed_sysfs_get_dm_name: supplied buffer too small_sysfs_get_kernel_name: failed to allocate temporary buffers_sysfs_get_kernel_name: dm_snprintf failedCould not locate device kernel name in sysfs path %s_sysfs_get_kernel_name: output buffer too smallDevice %s (%u:%u) appears to be mounted on %s.WARNING: sysfs_path dm_snprintf failed.Failed to set a proper state for notification semaphore identified by cookie value %u (0x%x) to initialize waiting for incoming notifications.Udev cookie 0x%x (semid %d) waiting for zeroCould not set wait state for notification semaphore identified by cookie value %u (0x%x): %sA non-block device file at '%s' is already presentUnable to unlink device node for '%s'%s not set up by udev: Falling back to direct node creation.Node %s was not removed by udev. Falling back to direct node removal.The node %s should have been renamed to %s by udev but old node is still present. Falling back to direct old node removal.The node %s should have been renamed to %s by udev but new node is not present. Falling back to direct node rename.Unable to rename device node from '%s' to '%s'%s: retaining kernel read ahead of %u (requested %u)%s (%d:%d): Setting read ahead to %uCould not set notification semaphore identified by cookie value %u (0x%x)Udev cookie 0x%x (semid %d) assigned to %s task(%d) with flags%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s (0x%x)Could not signal waiting process using notification semaphore identified by cookie value %u (0x%x) ( ( 8 H X h x /proc/self/mountinfoWARNING: Ignoring unsupported value for %s.%s not found in config: defaulting to "%s"%s not found in config: defaulting to %ld%s not found in config: defaulting to %fvsnprintf failed for config linedm_vasprintf failed for config linedm_pool_grow_object failed for config line_write_value: Unknown value type: %dFailed to clone config string value.WARNING: Ignoring duplicate config node: %s (seeking %s)Parse error at byte %td (line %d): expected a string token.WARNING: Invalid creation_time found in metadata (repaired with next metadata update).Parse error at byte %td (line %d): unexpected tokenParse error at byte %td (line %d): expected a valueParse error at byte %td (line %d): empty section identifierWARNING: Ignoring duplicate config value: %sdm_pool_begin_object failed for config line%s not found in config: defaulting to %dFailed to allocate config pool.Failed to allocate config tree.Cannot clone NULL config node.Failed to clone config node key.Failed to create config node's key.device_mapper/libdm-config.c%f0%lotruefalseFailed to clone config value.Failed to duplicate token.Failed to allocate type valueFailed to read int token.Failed to read float token.Failed to allocate value%s}[%s,%sconfig_outputFailed to clone config node.Failed to create config node.p   I-(hP_create_dm_tree_node alloc failed.dtree node hash insertion faileddtree uuid hash insertion failed_info_by_dev: Failed to set device number.Deactivation dm_task creation failed for %sFailed to set device number for %s deactivationFailed to set message major minor.Failed to process message "%s".WARNING: Can't set no_flush flag.Suspend dm_task creation failed for %s.Failed to set device name for %s resumption.Failed to set device number for %s resumption.WARNING: Failed to set read ahead.Device id %u is higher then %u.Expected thin-pool target for %s and got %s.Found transaction id %lu for thin pool %s with status line: %s.dtree node segment allocation failedFailed to allocate target segment area._deps: failed to set major:minor for (%u:%u)._deps: failed to set inactive table for (%u:%u)_deps: task run failed for (%u:%u)_deps: failed to get info for (%u:%u)Inconsistent dtree major number: %u != %uInconsistent dtree minor number: %u != %uNode %s must have only one segment.Expected vdo target for %s and got %s.VDO needs message for compression %u(%u) and deduplication %u(%u).Failed to format %s device number for %s as dm target (%u,%u)WARNING: Ignoring RAID1 stripe sizeFailed to get %s target versionsdtree uuid hash creation failedResetting %s udev_flags from 0x%x to 0x%x.Thin pool %s transaction_id matches %lu, skipping messages.Thin pool %s transaction_id is %lu, while expected %lu.Cannot send messages to thin pool %s%s%s%s.Thin pool %s already contain thin device with device_id %u.Manual intervention may be required to remove device dev_id=%u in thin pool metadata.Optionally new thin volume with device_id=%u can be manually added into a volume group.WARNING: When uncertain how to do this, contact support!Thin pool %s transaction_id is %lu and does not match expected %lu.Matched uuid %s (missing suffix -%s) in deptree.Matched uuid %s (missing prefix) in deptree.Not matched uuid %s in deptree.Couldn't find snapshot origin uuid %s.Couldn't find snapshot COW device uuid %s.Couldn't find merging snapshot uuid %s.Cannot add device without name and uuid._node_clear_table failed: missing nameFailed to obtain dependencies for %s before clearing table.Clearing inactive table %s (%u:%u)Table clear dm_task creation failed for %sFailed to set device number for %s table clear_node_clear_table failed: info missing after running task for %sFailed to deactivate no-longer-used device %s (%u:%u)Sent messages to thin-pool %s and skipping suspend of its children.Suspend dm_task creation failed for %sFailed to set device number for %s suspension.WARNING: Failed to set skip_lockfs flag.WARNING: Failed to set no_flush flag.Unable to deactivate open %s (%u:%u).Node %s %d:%d has open_count %dUnable to deactivate %s (%u:%u).Rename dm_task creation failed for %sFailed to set name for %s rename.Failed to rename %s (%u:%u) to %sCreate dm_task creation failed for %sFailed to set device name for %sFailed to set device number for %s creation.Failed to set read only flag for %sInternal error: Unable to get DM task info for %s.Reload dm_task creation failed for %s.Failed to set device number for %s reload.Failed to set read only flag for %s.Insufficient space for target parameters.Can create VDO data volume path for %s.V2 %s %lu %u %lu %u %s %s %s maxDiscard %u ack %u bio %u bioRotationInterval %u cpu %u hash %u logical %u physical %u%s 0 %u %s %d fix_padding block_size:%u internal_hash:%sNo parameters supplied for %s target %u:%u.Adding target to (%u:%u): %lu %lu %s %sTarget parameter size too big. Aborting.WARNING: Failed to suppress reload of identical tables.Suppressed %s identical table reload.Table size changed from %lu to %lu for %s.%sResume of table of extended device %s delayed.Insufficient space in params[%zu] for target parameters.WARNING: Failed to get uuid for dtree node %s.Couldn't find mirror log uuid %s.Unsupported cache's feature flags set %lu.Invalid cache's feature flag %lu.Data block size %u is lower then %u sectors.Data block size %u is higher then %u sectors.Missing cache's metadata uuid %s.Missing cache's origin uuid %s.Cache policy parameter %s is without integer value.Missing writecache's cache uuid %s.Missing writecache's origin uuid %s.Missing integrity's meta uuid %s.Missing integrity's origin uuid %s.Replicator segment is unsupported.Replicator targer is unsupported.Failed to allocate thin message.Cannot use same device id for origin and its snapshot.New transaction id must be sequential.Current transaction id is different from thin pool.Missing thin external origin uuid %s.dm_tree_node_add_target_area called without deviceDevice %s is not a block device.dm_tree_node_add_null_area() called on an unsupported segment typedevice_mapper/libdm-deptree.cname pool_strdup failedRemoving %s (%u:%u)Failed to set major minor.Resuming %s (%u:%u).no targetdtree link allocation failedNode %s is missing a segment.Node %s has segment type %s.compression oncompression offindex-enableindex-disableParsing VDO status: %s%s%s %lu%s %d %u nosync rebuild %u min_recovery_rate %u max_recovery_rate %u write_mostly %u max_write_behind %u region_size %u raid10_copies %u delta_disks %d data_offset %ddtree hash creation failedFailed to allocate dtree. in failed state which needs check first with read only metadataUUID "%s" does not match.create_snap %u %ucreate_thin %udelete %uset_transaction_id %lu %lureserve_metadata_snaprelease_metadata_snapMatched uuid %s in deptree.Dropping callback for %s.Reverting %s.Unable to deactivate %s. with device flush with filesystem syncSuspending %s (%u:%u)%s%sUnable to suspend %s (%u:%u)is used by another deviceconstains a filesystem in useDevice %s (%u:%u) %s.Renaming %s (%u:%u) to %sUnable to resume %s. read_only error_if_no_space no_discard_passdown ignore_discard skip_block_zeroingCreating %sFailed to set uuid for %sLoading table for %s.clustered-userspace %u %s clustered-%s%s %u 1 handle_errors%s %s %c %d%u %u /dev/dm-%u%s%s%s%s%s %s %lu %s %s %d %lu %d%s%s%s%s%s%s %d%s metadata2 passthrough writeback writethrough migration_threshold %u %s %lu%s %s %s %u %d high_watermark %llu low_watermark %llu writeback_jobs %llu autocommit_blocks %llu autocommit_time %llu fua nofua cleaner max_age %u meta_device:%s recalculate journal_sectors:%u ineterleave_sectors:%u buffer_sectors:%u journal_watermark:%u commit_time:%u bitmap_flush_interval:%u sectors_per_bit:%llu (Ignoring.)log uuid pool_strdup failedUnsupported raid type %s.Missing cache's data uuid %s.No integrity meta uuid.Missing metadata uuid %s.Ignoring %lu of device.Missing pool uuid %s.Unsupported message type %d.Missing thin pool uuid %s.Couldn't find area uuid %s.Missing VDO's data uuid %s.YN8NNMJM~N`h؅X((((((((((((((((((cachecrypterrorlinearmirrorsnapshotsnapshot-originsnapshot-mergestriped zero writecache integrity thin-pool thinvdoraid0raid0_metaraid1raid10raid4raid5_nraid5_laraid5_raraid5_lsraid5_rsraid6_n_6raid6_zrraid6_nrraid6_ncraid6_ls_6raid6_rs_6raid6_la_6 raid6_ra_6raid5raid6raid10_neardevice_mapper/libdm-file.cCreating directory "%s"process is already runningExisting path %s is not a directory.Failed to duplicate directory name.Cannot open lockfile [%s], error was [%s]Cannot lock lockfile [%s], error was [%s]Cannot truncate pidfile [%s], error was [%s]Cannot write pid to pidfile [%s], error was [%s]Cannot write pid to pidfile [%s], shortwrite of[%zu] bytes, expected [%zu] Cannot get close-on-exec flag from pidfile [%s], error was [%s]Cannot set close-on-exec flag from pidfile [%s], error was [%s]Cannot check lock status of lockfile [%s], error was [%s]dm_report_enable_compact_output: dm report handler is NULL.Internal error: %s reserved value handler for field %s has missing implementation of DM_REPORT_RESERVED_PARSE_FUZZY_NAME actionError occured while processing %s reserved value handler for field %sdm_report: Unable to extend output linedm_report: struct field_properties allocation faileddm_report: field not match: %sdm_report: Ignoring duplicate sort field: %s.Internal error: Field type undefined.------------------------------------------------------------------------------- field - Reporting field. number - Non-negative integer value. size - Floating point value with units, 'm' unit used by default if not specified. percent - Non-negative integer with or without %% suffix. string - Characters quoted by ' or " or unquoted. string list - Strings enclosed by [ ] or { } and elements delimited by either "all items must match" or "at least one item must match" operator. regular expression - Characters quoted by ' or " or unquoted._display_selection_help: dm_pool_begin_object failed Logical and grouping operators:dm_report_field_string_list: dm_pool_zalloc failed for sort_valuedm_report_fiel_string_list: dm_pool_zalloc failed for sort value itemsdm_report_field_string_list: dm_pool_strdup faileddm_report_field_string_list: malloc faileddm_report: struct selection_node allocation failed_compare_selection_field: field without value :%dInternal error: _cmp_field_int: unsupported number comparison type for field %sInternal error: _cmp_field_double: unsupported number comparison type for selection field %sInternal error: _cmp_field_string: unsupported string comparison type for selection field %sInternal error: _cmp_field_string_list: unknown list typeInternal error: _cmp_field_string_list: unsupported string list type found, expecting either AND or OR list for selection field %sInternal error: _cmp_field_time: unsupported time comparison type for field %sInternal error: _compare_selection_field: unknown field type for field %s_add_item_to_string_list: memory allocation failed for string list itemdm_report: dm_pool_begin_object failed for headingsdm_report: Could not allocate memory for heading buffer.dm_report: snprintf heading faileddm_report: Failed to generate report headings for printingdm_report: Failed to copy field namedm_report: Could not allocate memory for output line buffer.dm_report: left-aligned snprintf() faileddm_report: right-aligned snprintf() faileddm_report: Missing sort field namedm_report: Unrecognised field: %.*sUnrecognised selection field: %sSelection field is uncomparable: %s.Unrecognised comparison operator: %sRegular expression expected for selection field %sFailed to parse regex value for selection field %s.Operator can be used only with number, size, time or percent fields: %sOperator can be used only with time fields: %sFailed to parse string value for selection field %s._tok_value_string_list: memory allocation failed for selection listInvalid operator in selection list.List ended with incorrect character, expecting '%s'.Only one type of logical operator allowed in selection list at a time.Internal error: _tok_value_string_list: list has no items_tok_value_string_list: memory allocation failed for sort arrayFailed to parse string list value for selection field %s.Failed to parse numeric value for selection field %s.Found percent value but %s value expected for selection field %s.Found size unit specifier but %s value expected for selection field %s._tok_value_time: dm_pool_strndup failedField selection value %s out of supported range for field %s.tok_value_time: dm_pool_strndup failedSpecified minutes out of range.Specified seconds out of range.Full date specification needed.Failed to parse time value for selection field %s.Internal error: Forbidden NULL custom detected.Unable to create selection with field '%s' which is not included in current report.dm_report: incompatible comparison type for selection field %sdm_report: struct field_selection allocation failed for selection field %sdm_report: struct field_selection_value allocation failed for selection field %sInternal error: %s reserved value handler for field %s has missingimplementation of DM_REPORT_RESERVED_GET_DYNAMIC_VALUE actiondm_report: could not get reserved value while processing selection field %sdm_report: malloc failed to store regex value for selection field %sdm_report: failed to create regex matcher for selection field %sdm_report: dm_pool_strndup for value of selection field %sString value %s found in selection is reserved.Numeric value %lu found in selection is reserved.Size value %f found in selection is reserved.Percent value %s found in selection is reserved.String list value found in selection is reserved.Time value found in selection is reserved.Internal error: _create_field_selection: unknown type of selection field %sInternal error: Forbiden NULL custom detected.Missing list end for selection field %sFailed to allocate report selection structure.dm_report_field_string: dm_pool_strdup faileddm_report_field_int: dm_pool_alloc faileddm_report_field_int: int too big: %ddm_report_field_uint32: dm_pool_alloc faileddm_report_field_uint32: uint32 too big: %udm_report_field_int32: dm_pool_alloc faileddm_report_field_int32: int32 too big: %ddm_report_field_uint64: dm_pool_alloc faileddm_report_field_uint64: uint64 too big: %luInternal error: Using string as sort value for numerical field.Internal error: dm_report_init: definition of report types given contains reserved identifierdm_report_init: allocation of memory pool failed_canonicalize_field_ids: dm_pool_alloc failed_canonicalize_field_dup: dm_pool_alloc failed.dm_report_set_output_field_name_prefix: dm_pool_strdup faileddm_report: Unrecognized field: %.*sdm_report_field_percent: dm_pool_alloc failed for sort_value.dm_report_field_percent: dm_pool_alloc failed for percent report string.dm_report_field_percent: percentage too large.Failed to create cache for values used during reporting.Internal error: _check_reserved_values_supported: global reserved value for type 0x%x not supportedInternal error: _check_reserved_values_supported: field-specific reserved value of type 0x%x for field %s not supportedInternal error: dm_report_init_with_selection: trying to register unsupported reserved value type, skipping report selectiondm_report: dm_report_output: interleaved reports detected for JSON outputdm_report: dm_report_output: unfinished JSON output detecteddm_report: sort array allocation faileddm_report: Unable to allocate output linedm_report: Failed to extend row for field namedm_report: Failed to extend row with separatordm_report: Failed to terminate rowdm_report: Unable to terminate output lineInternal error: _do_report_object: dm_report handler is NULL.Internal error: _do_report_object: output not requested and selected output variable is NULL too._do_report_object: struct row allocation failed_do_report_object: row sort value structure allocation failed_do_report_object: struct dm_report_field allocation failed_do_report_object: no data assigned to field %s_do_report_object: report function failed for field %sdm_report: dm_report_init_group: failed to allocate mem pooldm_report: failed to allocate report group structuredm_report: faile to allocate root report group itemdm_report: dm_report_group_push: group item allocation faileddm_report: unable to add more than one report to current report groupdm_report: failed to duplicate json item namedm_report: can't use unnamed object at top level of JSON outputdm_report: dm_report_group_pop: group has no itemsSet if item passes selection criteria.Matching regular expression. [regex]Not matching regular expression. [regex]Equal to. [number, size, percent, string, string list, time]Not equal to. [number, size, percent, string, string_list, time]Greater than or equal to. [number, size, percent, time]Greater than. [number, size, percent, time]Less than or equal to. [number, size, percent, time]Less than. [number, size, percent, time]Since specified time (same as '>='). [time]After specified time (same as '>'). [time]Until specified time (same as '<='). [time]Before specified time (same as '<'). [time]device_mapper/libdm-report.ctype-specificfield-specific": [string listunselectable %s Fields%*.*s %sall%-*s - %sAll fields in this section. %-*s - %s%s%s%s%sSelection operandsReserved values %-*s - %s [%s]Selection operators------------------- Comparison operators: %6s - %s %4s - %sUnsupported selection type%-*.*s\Missing end quote.%s: field name too long.Unrecognised field: %.*sExpecting field nameMissing value after operatorSpecified month out of range.Specified day out of range.Specified hours out of range.report selectionExpecting logical operatordm_report_init: malloc failedreport_groupShow help.Specialspecial_&&All fields must match||At least one field must matchLogical negationLeft parenthesisRight parenthesisList startList endList subset startList subset end=~!~!=>=<=sinceuntil~Incorrect time format.Incorrect date format.Failed to parse string list value for selection field %s._display_selection_help: dm_pool_grow_object failedSyntax error: right parenthesis expected at '%s'Syntax error: left parenthesis expected at '%s'?= # and <#devices> and Failed to parse %sraid params: %s %u %lu/%lu %u %lu/%lu %lu %lu %lu %lu %lu %lu %lu %dFailed to parse cache params: %sFailed to parse writecache params: %s.Failed to parse integrity params: %s.Failed to parse invalid thin params.Failed to parse thin pool params: %s.Failed to allocate thin_pool status structure.Failed to allocate thin status structure.Failed to parse thin params: %s.Failed to alloc mem pool to parse mirror status.Internal error: More then 8 reported in mirror status.Allocation of log type string failed.Failed to parse mirror status %s.device_mapper/libdm-targets.c%lu/%lu %luInvalidMerge failedOverflow<#devs> %s %u %s %lu/%luErrorFailwritethrough writeback passthrough metadata2 no_discard_passdown Unknown feature in status: %s%d ro needs_check%llu %llu %llu %llu%llu %llu %s%lu %lu/%lu %lu/%lu%nout_of_data_spacero Allocation of devs failed.%u:%u %nuserspaceAllocation of logs failed.get_timestampclock_gettimedevice_mapper/libdm-timestamp.cOut of memory. Requested %zu bytes.Couldn't create memory pool %s (size %zu)Internal error: pool_free asked to free pointer not in poolYou have a memory leak (not released memory pool):Internal error: Unreleased memory pool(s) found.Internal error: Pool %s is already locked.Internal error: Pool %s is already unlocked.Internal error: Pool %s crc mismatch.device_mapper/mm/pool-fast.cdevice_mapper/mm/pool.c [%p] %sPool %s is locked.Pool %s is unlocked.device_mapper/regex/matcher.c(.*(%s)%c)Couldn't parse regexregex fingerprint(rx->type != OR) || (rx->left && rx->right)Internal error: Unknown calc node type~~~_fill_tableIncomplete rangespecificationBadly formed 'or' expressionParse error in regexRegex optimisation errordevice_mapper/regex/parse_rx.cBadly quoted character at end of expressionmissing ')' in regular expressionRegex charset allocation failedH8`device_mapper/regex/ttree.ccouldn't get token for '%s'couldn't parse '%s'out of memorycouldn't get token for deviceoperating modeindex statecompression stateused blockstotal blockstoo many tokensrecoveringread-onlynormalerrorclosedopeningclosingofflineonlineunknownonlineofflineVDO minimum io size %u is unsupported [512, 4096].device_mapper/vdo/vdo_target.cVDO block map cache size %u MiB is out of range [%u..%u].VDO block map era length %u is out of range [%u..%u].VDO index memory size %u MiB is out of range [%u..%u].VDO slab size %u MiB is out of range [%u..%u].VDO max discard %u is out of range [%u..%u].VDO ack threads %u is out of range [0..%u].VDO bio threads %u is out of range [%u..%u].VDO bio rotation %u is out of range [%u..%u].VDO cpu threads %u is out of range [%u..%u].VDO hash zone threads %u is out of range [0..%u].VDO logical threads %u is out of range [0..%u].VDO physical threads %u is out of range [0..%u].Internal error: VDO write policy %u is unknown.Value of vdo_hash_zone_threads(%u), vdo_logical_threads(%u), vdo_physical_threads(%u) must be all zero or all non-zero.VDO logical size is by %luKiB bigger then limit %luTiB.Failed to allocate memory for hash.Failed to allocate slots for hash.base/data-struct/hash.cbase/data-struct/list.chead->nhead1->ndm_list_splicedm_list_add_hdm_list_add`Ш0@HhhЫ0 +?xӰ0Ppرл pp `xx_dump_degrade_to_n48_degrade_to_n16_degrade_to_n4unused value is not UNSET (n4) unused value is not UNSET (n16) referencing value past nr_entries (n48) not all values are referenced (n48) incorrect number of entries in n48, n48->nr_entries = %u, actual = %u unused value is not UNSET (n48) incorrect number of entries in n256, n256->nr_entries = %u, actual = %u ./base/data-struct/radix-tree-adaptive.cincorrect entry count: rt->nr_entries = %u, actual = %u duplicate entry (n48) %u value in UNSET (n48) unknown value type: %u shouldn't get here n4 != NULLn16 != NULLn48 != NULL values[i].type != UNSETP0>d>?@@PAA`B@CHC@DE0F\FxF`GHH@LMNd0OpORSSdU`V8Xl0XPXXX@Z(`Z<[\\\\(\H^c8d@g0i$@ppt\xyy(zXh|Є@`0@P@ lP HЕp4@``|0@p8PpМ@0P(`p@p$`08T@P p H@p@0p@$08@@@P,PP$ 8@LP PD`@ ` pD@p!P%'0)D*h+-0 .\0.p/`4,<== = @p0BPF@GdJKL@LTTU U@U0`UDU`VV@XpX X Y\Z]^`^ _0_D``X`l`abPbbb,depi\ k`l@( 0|p@`l P(<Pd@PpЗDXИP`8h0pLP X`x@p(pP0а( Hhpд8`x` Hh@8нTо`pD  P\ 0  ( Pd `    8  d 0x p  ` `8 l @ Hp0<0P| 0XpPp`P4 ` (@<P"# $%@`')  +d++,P,,,,,@,T-/123, 3@77P8D:;(p<`@>P>>p ? ?@??0@ A 0A!XA`!xA(A( B( B0*B@+B+B ,B-`C-tC`1C2Cp30D3DD3\D3pD4D4Dp4D4D5,E5@E5TE5tE6E6E7E07E@7EP7E7F7(F7CxCEF<0Gh0IIIJ0JPJ,J@JTJhK| K0K@K`KKKKKK0KDKX L`LLM$ML N0NPNNO@OPdWXY8pYPYp`Z`[_p__`@```@eg@iHjxkl@m,`nxrPst@tX u`x,0~ P X      T  Ћ P  d  <P@P ` @TЗh| 0@`p0DXЙ0@P0DX l0@P`p  4ЛH\p 0@Pp$8L`Мt 0@P,HН\Р 8 @$ @|``0Hx@P@@lЭ@0PD`Xа 0`0@pл,о$H0h@|P` 8L0@P`h0`  `X @ p !@!!"4"""P"0#D# X#@l#`###### #@ $` $4$H$\$p$$ $@$`$$$$%$% 8%@L%``%t%%%%%@%p& &<&X& t&@&`&&&' '@8'pT'l'''''0'P(p0(L(h((((0(P(p),)H)d)) )@)`)) *(*D*`*0|*`****+0$+@+\++@+`++,0,,PH,d,,,,@,p, -(-D- `-P|-----@.p$.@.\.0..../,/PP/t///0/P/0080T0@p0p00000 0@1`01D1X1l111 1@1`111 2 242H2\2p2`222p23P43P3Pl3333344040|444P5,5X5p55 6@ p6 6 6 $7 `7p 7 77 88t88p880$9`9@99 :X:t:P::P:;4;ph;;0; < <@\<p<<< <<0$=P= =p"=P#=#8>p$>%>&?`5P?6|? 7?P7?7?7?7?8@@8@p8(@8<@8P@9d@P9@9@9@:AP:,A:TA:|A`;A;ABP>B>B0?Cp?0C?DC@@XC@lC@CAC@ACACBC@C$DpC@@@<@hA@A`B B8BL@C`E`FFGG4HT HhHHI`IIJ8JTKpKLL`LLLMDMXMtMpNO P,PpP0QQQR`R S`TT,U@WWX`XXY[` 0`@P`0$0(@88pPpXpt 0400\@p0Xx p "$`(8chXjl8mpnn|H0@ PT@@Тd`@`TXL h  | @ P ` p   @P   p h  0  L     0 P  @` 4PPl`@X`@ "%D%X0&@&&&&P+h`,,,,-(0x26t:= p>T>hD Hp0JPKK<MN`O @P8VZ[P@]^0_0Pb|e`iTt`}@X4 | ,x0Ѝ  8! !!кX#4$%D&Px&0&(((@)p)@ ) )"@*0#*P#*p#*@$+$,+ &h+'+'+@(,.,/,2-5h-6-P=T.@.F /Hl/K/L 0@MD0M0pN0X01Y1[1]@2^2`3b3e3 g@4`h4 ~055P56Џ667pH7p7P8888@9t9$:0::`X;; <`<<<==,=x====4>H>>>`>?`h?? ?@@ @L@@@@@0A4A0LA@A@AB,C`C |CC0CDhD@DPDDDD`DDE$EpE F8FhFDG\GxGGGHp\H|H`HH@HHP I$I8I LI0`III I@IPIILJ J0 J J J K0 KP 0Kp DK XK lK K K` K K Q>Q?R@ R AtRG SISISPMLTpOTpPT Q UQ8URUU V@V VV4VVHVV\VWpVPWVWVWVWVXV Y WYPW\W`^XpcX dY`ftY gYgYg Z@h8ZhdZixZiZ`jZl [ox[ o[0o[Po[`o[po[o[o\ p,\ rt\s\t\0x]px]x]x^0y<^PyP^`yd^yx^y^@z^Pz^~_P``І` aa abb`8bb0b@bb`c0cИLdp,ePeP4f0lfffPf$gdgg g@8h`hhбhh@,ipiеi`i0jpj0jHk@dkkklp`lPllpm$m8mLm`mtmm mmmm0nP$np8nLnhnn0nPnpnnnno0(oPEKG QJG$<p1AEKG QJJ$d1CEAJ nCA$1FEAJ qCA$1FEAJ qCA2:AU J Y(02GBDA uDB(T2:AtDx2*E`X`2dBBA A(D08O@W8A0D (F CBBE K (C ABBE 43JBAH q ABA FAB3]D4BFA D(D` (A ABBK hQp[hA`P|5D@ D l 6D@ I 6A` G ~ J 07H G F7 7(7>FHC iAB 7 476H7@H[ E UHh8FBA H(D0p (C ABBC D(F ABB0h8EKD  DAJ DAA9@4@9\FEA h ABA \AB4h9 \Hd9FBB B(D0A8M@p 8A0A(B BBBA D8N0H(G IBB\9FBB B(D0A8M@p 8A0A(B BBBA D8N0H(G IBBD:@:BBE B(I0D8JL^Aa 8A0A(B BBBD DNkBMSKMEPH\@2Ee F A |@Ko F s E @PHh H W<(AFHA DP  AABH VXM`\XAPTAcEb I rt8BLEFlB hB dB4pBFHA k FBF QCBBHU8BFGA ] ABB F CBE xXTCFEB B(D0A8D@[ 8F0A(B BBBF h 8C0A(B BBBD  8F0A(B BBBI hD4EnDkDYEO ,EFBB B(A0A8D7MMKI 8A0A(B BBBF IMNPBHQDI\HFEB B(A0A8G 8A0A(B BBBG HTDN`SE@M]BLI\DMKaADM]EIELFKK^MFADY\hIAHFIXUAHKYUAHKYUAHKYUAHKYUAAK$`FBNKhBwMeUK_BRI^DWMkB]M^A|J_A_K^AK^DnK_BH]AK_BSKmBXK^AKmBXK^BsKmARIBMgBR MW xdc5H] K DHcBBE E(D0A8Dp 8A0A(B BBBH He De @e& \e(FEF B(A0D8G` 8D0A(B BBBI h\pLxGBBI`hWpHxLGAS`hUpExGBB[`h\pRhB`WhNp\hA`ZhNp\hA` hUpExGBBI PhKpLhF`@!lHFFB H(A0G 0A(A BBBK <H!mFNO M(A0 (A BBBE !to!o!oFFB B(A0D8G~VMGTS[AQMaIU HbAaMQ }M`Bk 8A0A(B BBBA H`"sFBE A(D0L (C ABBJ D(F CBBt"s*FBA A(G08M@\8C0D (A ABBG  (A ABBH t (C ABBD X 8P@P $$#uXYQM \CA$L#uIEEG nDAt#u!EW#u!EW#vBFBE B(A0I8JMIaFrLUEy 8A0A(B BBBE ~^PARFJA<${,HJJ O\${p${${4$|EDH E CAF U CAG 4$|EDH N CAE u CAG H%d}FBB E(A0Q (C BBBF F(C BBBHT%}FBB E(A0Q (C BBBF F(C BBB%} H%}FBB E(A0R (C BBBE F(C BBBH&}FBB E(A0R (C BBBE F(C BBBL&0~6Ea J El&P~&HZ&h~ &d~ &`~ &\~ &X~&T~&P~'L~$'H~8'T~ ,L'P~QHD ABJ|'~VD'<FIB B(A0A8D@u8A0A(B BBB'1Ek'JRXVI(!(( <(H@ H 8X(yODG DAAHH FAAH(؀FED A(M0V (A ABBG D(N HGI0(BDA sABL4BGA D(K0 (M HGIO d (A ABBF X 5\}BGB A(A0 (D BBBA t (A EBBB D8K@[8A0|57Aa N F45AHG y CAC p CAD $5CAAG wAA05rBLD D  AABG (06>BDA sABD\6\BDA G  AABF RMTTK06(ADG K CAE mCA86BBD A(D0x (D ABBB p71BBA A(G0b (C ABBI D (F CBBG j (C ABBF l (C ABBD P7BAA  ABK P ABE d ABA d ABI P7BIB A(A0Gpd 0A(A BBBF LxCexApH08BGB E(A0A8G@X 8C0A(B BBBC P|8`fBHD  ABF i ABD d ABA [ ABB 8|An A v J H8BIA A(D0X (C ABBG D(F CBB(@9<EAD y DAH Xl90BEB B(A0A8Dpm 8A0A(B BBBA ZxH`xAp|9FIB B(A0A8G@ 8F0A(B BBBB I 8C0A(B BBBK  8A0A(B BBBF H:BBA A(G L@LA}AMAYABA' (A ABBI !AMAMAQBNAZAOA[AFA1AMAMAQBNAcAUAFAFBFBFBFBFBFBFBFBFBFBFBWAQAIA^AAA4(;DAHG M DAN o CAE 0`;QEHD h FAH DCAD;"FBB A(A0D 0A(A BBBD H;FFA A(D0R (D ABBC D(F ABBH(<$FFA A(D0P (C ABBF D(F CBBPt<hFBB B(D0A8D@WHDPhHI@G8D0A(B BBB<SEM<1Ek<=<AAN _ CAE L CAH jCA@=BEx$\=EI B  K ,=FAF S ABE H=uFMN B(A0I8D@ 8C0A(B BBBG ,>LBFAA  CBF p0>l FEB E(D0F8KPXF`HhBpWP 8D0A(B BBBE # XM`ThBpE > > > > > ? x? \MIE E(D0D8JP[XG`OXAPP 8D0A(B BBBG `PPHXL`vXAP8? EO_ R HAJ D(M0cCA8? EO_ R HAJ D(M0cCA8@LEO_ R HAJ D(M0cCATL@BEB B(A0A8D@W 8C0A(B BBBD ZHOPMHA@\@BBB E(D0A8D 8A0A(B BBBE |QjAXAxBBB D(D0G@ 0A(A BBBB F 0A(A BBBB H`AYBEE E(D0D8DP 8D0A(B BBBF LA~BID A(G`hMpYhA`v (A ABBC N hMpM A  BuH x H ,Bz@BPE] F g`BzYp G gHB|FBB B(A0H8G 8A0A(B BBBF BpE{ H gB [QV I j C` KjG A(H0K40C hBDC u(R0R(A AABhC!)BPE E(D0G8DP 8D0A(B BBBE XE`QXAPXF`LXHP^XF`MXBPXF`LXBPDXF`LXAP`C&=BBB B(A0A8D`ihKpQhA`b 8A0A(B BBBH lhKp_hA`H\D'jBHE I(H0C8Np% 8D0A(B BBBE `D)FEB E(A0A8G 8A0A(B BBBF MCHN E-HTH$E-FFEE B(D0A8D@| 8D0A(B BBBD XpE.FBE A(A0J} 0A(A BBBB IHCVPE/8FBA A(GDHCNE (A ABBB  F1qJZ$O`ZNE^ E 4OZEAD r AAB e CAG 4 PZEAD r AAB e CAG 4XPd[fFED A(D0K(A ABB$P[:EDD jAA4P[OFAA q FBG ACB@P[xFAA e ABH G DBK bCBL4Q\FBB A(A0[ (C BBBH F (C BBBI HQx\FEE G(A0b (C BBBE F(C BBBHQ\mFBA A(D0H (A ABBD F(A ABB4R\WFDD ] FBE YCBHTR]!FBB B(D0G8F` 8A0A(B BBBA HR]FHE E(A0A8D`% 8A0A(B BBBC RP_ SL_ SH_ (SD_'Ae$DSX_=ASF `AA8lSp_]FBF A(A0@(F BBB(S_>BHD lABS_gFBB B(A0A8Dp; 8A0A(B BBBI x\RxApwxS[xCpFxOODNpPx^DAADNpKxMRDNp|Tpb*A\ C EDTbEDG t FAE D(C0i(F D AAD D(F0<TbEAG m FAG T(C0h(A IAA0$UHcEAG j DAL |DAXUcFEB E(D0C8G`hMpVhA`N 8C0A(B BBBD v 8A0A(B BBBH c 8F0A(B BBBF A hMpJ c 8C0A(B BBBI nhOpYhA`bhKpihD`vhOpfhD`FhOpOxAN`Ph^pDxAAAN`UhMpRxAQ`H`V,gFOB J(D0A8G 8A0A(B BBBG 4VhPFEA b HBH HABXVhREB D(A0u8D@T8A0E (A BBBH I(A BBBH@W\hBBD E(D0c (C ABBD D(C CBBWh+TV(WhAAG@v AAA `Wi)BBE E(D0H8Dp 8A0A(B BBBD txN[xApf xNJ \4XjFBA A(D0 (D ABBG w (D ABBH r(D ABBX8lPEJHXllFBB E(D0G8D`} 8A0A(B BBBA X oYo $Yo08YoFDC G@P  AABH TlYoFEE B(D0A8Dp\xLfxCpX 8A0A(B BBBB YHrEe F B ^ 4YrFFH G(D0a(A ABB ZEk H Ayt=dN 0yuLb B zFTy^FEE B(D0A8Ik 8A0A(B BBBK XzHAHFFO`MZBHN[Ayzz(zFBB H(A0A8D` 8A0A(B BBBG DhNp[hA``hFEI B(A0H8FPX 8A0A(B BBBI D8F0A(B BBB̪ ND9p 0l Dh <XdED G qF H(A0\C A pF H(A0x$FDA V(c0R(B Y ABD K(a0M(F0q(A e(P0K(C A ABH e(H0H8C@N CABxxFBB A(A0G I } 0A(A BBBG @ I b A f P J D T N ^ B d)BEB D(D0GPJXK`^XAP[ 0A(A BBBA RXI`aXAPGXM`\XBP4KFED a ABE KAB0D{FPD D(A0[8E@G8B0x8O@d8B08H@VHRPI0[ (A BBBE J8M@\8C0A (A BBBB c8H@g8A0 (C BBBG S8H@b8B0 8P@J (E^(vEID s DAF HBBE E(D0C8GPOXL`iXFP 8A0D(B BBBI JXG`dXAPTXJ`]XJPDXF`IXGPWXI`hXFP]XM`\XAPK8A0A(B BBB4JDH l FBF mCB4, AEFP_ AAC aXR`HXCPd!x!FBB A(A0G L@I@@N@e@E@Q@C@t@A@Z 0A(A BBBD @M@O@C@N@y @K@O@J@N@q@K@H@A@I ~@A@H@C@N@x@A@H@B@Y@h@Q@K@A@p\$;FIB B(A0D8JUBAIP\D 8A0A(B BBBD а(FFB E(D0D8IK^Da 8A0A(B BBBJ xNWCIs FN K_B?N\Eh]PBH0FBE E(A0A8G 8A0A(B BBBJ Xб|1TFBB B(D0D8Gpo 8A0A(B BBBD `xM^xAp,44YVH4WH_ I f4h4sEAD N CAD a(g0H(A 4,5&UAA DABBP Xز$6FBB B(A0D8DPl 8D0A(B BBBB XK`YXAP4X:Hd:/Eidx: xt:8:FJD A(D@ (A ABBH (ȳ;EIGp AAI 8<FEE D(I0r (A BBBJ 04@. *JFAH m ABA FAB4x.$*rFIG J ABE FAB.l*.*HRH.*FEJ Q(H0K (D BBBE H(D IBB((/T+fFDD d ABK T/+>h/+9|/+ /+EG G AD /,4/,FDA G CBI dAB0,FEB B(D0A8G`h[pFhA`D 8D0A(B BBBG ]hYpThB`m hPpO DhFpMxVN`IhFpmhA`m hZpL K hPpJ 0/}EK H d40\0iEDG0g8f@O8A0X AAI (01FHD AB($1X2>FHC iAB@P1l2EDD j CAE W CAE D(T0Y(A 13*T1$3FBB B(A0A8DP} 8A0A(B BBBG XI`^XAPH23BBB B(D0A8DPy 8D0A(B BBBI HL2p4FBB E(D0D8DPz 8D0A(B BBBF @24EAG | CAC V CAF u CAG `25FBB B(D0A8D@zHIPzHA@ 8D0A(B BBBE THNP_HA@@3l8 dT3h8FBD A(N0C (F CBBE u (C ABBC L8N@\8A0F(A ABB393 9G\j3D9I839FAD ] ABE  ABF 84$:HN4P4,:gDJ Y CAF DFAE84:FJK A(D0M (D ABBJ (4X;ANAD iAAB$4|;=EDN _AA5;FLE B(A0K8LkLGFCkA[ 8A0A(B BBBG O[A OU | FV OTII} VJ 5?FSB B(A0K8GNaEpMYBl 8A0A(B BBBJ M\AaN[Dd\6 CFBB B(A0A8Gpy 8D0A(B BBBE UxKmxAp!xM\xAp06hFFAD GP  AABA h6G?BEH A(D0h (A BBBE  (A BBBK e8F@h8C0A(A BBBd7GHx7GFBI D(A0 (D BBBG T(A EBBD7XHFEA D(GP (A ABBC dXF`jXAP8 8IZFBI A(A0(A BBBLH8IFBE B(A0A8G2 8A0A(B BBBD 8TKL8`KFBB E(D0A8D' 8A0A(B BBBG <8NPBA A(D0(A ABBH0<9NiFKD D@  AABI p9PEn M b F H9(QFEB B(A0A8D@B 8C0A(B BBBE ,9QFDI h ABB :-Q[(fP>>FAA mFBfd>`f> g?Sg?,Dg,g@:Ah G I\Lg0@:BEB D(D0| (F BBBG b (C BBBE `(C BBB$gAgaMV [FA0gXAAX G IK ^CA J IK $hAAu J G I G40hBADF  FAA e CAA @hhBBBB D(C0F@ 0A(A BBBJ @hCwRAD P FBA U(L0^(C AAB@hCBBB D(A0IP 0A(A BBBH 84ixExBED D(G0T (C ABBF `piEBBE E(A0C8DS 8A0A(B BBBE FGBI@iL;BBE A(A0G@' 0A(A BBBG `jNBBA D(G0_8L@SHFPK0I (A ABBB V8I@`8A0I(A ABBX|j`N}FBB B(A0A8D@ 8F0A(B BBBA _HFPHHA@jP4jPQzBDA U ABA VAB$kQ BBE B(A0C8GOWBTHD^ 8A0A(B BBBI fK~A`LAPM]BM\Hk[BEE D(A0e (A BBBC c (A BBBF d (A BBBE W (A BBBB d (A BBBA O8M@\8A0`ll\xBED D(D0j (C ABBK k 8P@M U8M@\8A0F (A ABBE Hl]BED G(G0s (F CBBG C(C ABBDmP^BHB E(D0D8FP8D0A(B BBBhdm^)BBE I(A0A8GpxNLMNp` 8A0A(B BBBD AxM\xApHm`FAD (M0\(D J CBJ ` CBK W(P0nPa,@0nlaGAA p(L0^(D J CBJ `CBtnanayUY4nLbBDD z ABI JAB,nblAC FM2 G ov8ow9BED D(GP (A ABBH XoxKD] G Dto8xBBB B(A0A8D@8C0A(B BBBloxBDB B(H0H8D` 8A0A(B BBBJ xhIpghA`v 8F0A(B BBBB H,p0{^BBB B(A0D8Dp 8A0A(B BBBK xxpD BBE B(D0D8G`hNpVhA` 8D0A(B BBBE |hMp\hB`hMp\hA`^ hPpL 4p؂<FBD D(G0N(M ABBL,qBBE B(A0D8D 8A0A(B BBBC |qqqȅqԅqqqrr0rDr(Xr4lr@rLrXrdrpr|rr s sT4sJBB A(A0J8I@^8A0C (A BBBD E(A BBBHsBBB A(A0q8K@i8A0A (A BBBJ s5BBE B(D0A8G@HKPeHA@BHKPhHA@z 8D0A(B BBBE wHMP`HB@HMP\HB@ HPPP jHQPhtDvEF E t:H l A tȋ&H]t (t܋FAA AB`tpFBE E(G0G8F@} 8A0A(B BBBC D 8D0A(B BBBG ``u BEB B(D0A8G` 8A0A(B BBBF RhDpOxDAGI`uHkBEE E(D0C8GLgB@M\A  8A0A(B BBBK H_B'M\B NdAPS hHDvHFBB B(D0D8GpxK}xAp 8A0A(B BBBJ YxORMKp[xPLxBpTxhIxBp(wKFAA {ABH@wܡBBB E(D0A8J 8A0A(B BBBK wBBE B(A0A8GN\Bl 8A0A(B BBBD KEEDEBAHALeHA0(xԭBAD F@m  AABB \xGEU F f|xЮGEU F fxhBBE B(A0H8FIGIIBABBBN 8A0A(B BBBI yOGBBBAEBHSN\A\TyBED F(G0y (C ABBG e (C ABBC g (C ABBA yHOE_ D fyxOE\ G f@yBEE A(D0FPj 0A(A BBBG 8zDOE\ G fXztOE_ D fxz BBB E(D0D8GLDB 8A0A(B BBBD pK^AqMMDg NR L^Cr NR hHIB PJ RLQFDT{dFBB B(D0D8G@w8A0D(B BBB{{ D{dFBB B(D0D8G@w8A0D(B BBB | | D4|cFBB B(D0D8G@w8A0C(B BBB||| D|aFBB B(D0D8G@w8A0A(B BBBD| dFBB B(D0D8G@w8A0D(B BBB4}HBBE B(D0A8GM`BNFA 8A0A(B BBBA J PN " PN  PN B PN M\A(}$8FAD ZIB~8(~44<~0FFBA D(G0a(G ABB(t~H8FAD ZIB(~\8FAD ZIB~p4~lIFBA D(G0a(G AEB4XFBD D(D0r(F ABBPd,x EC HH F h7 TFBE E(H0C8G`^hMpThA`D 8D0A(B BBBK h<PFBE E(A0A8D 8A0A(B BBBI JXAg PJ QFEE A(D0 (A BBBK g (A BBBB 8F@Q8A0l8E@P8A0  (A BBBB o (A BBBJ d8t~FBB B(A0D8D@}HFPOHA@{ 8D0A(B BBBH *HMP\HA@4T+FBE B(D0D8G%`PBFLF<M\A  8A0A(B BBBC I^HDNHBWZP`ARM\ALfPBM\AM`BDTBF PG qZRFKNBA FE yKHLU]KCKTIBTHGNMMAJaCAKeONADcmB DE 1cnAJKANHAYTIA؃ TFBE B(A0A8D@~HHPaHA@H 8D0A(B BBBF 4l FAD D0~  AABG L FEH D(D0q (D ABBK F (D ABBA  jsm8  BGA D(D@h (A ABBH H \ 6dNt HM ^Eb,aCN N(V0gCA؅d `5EO D \ NET G m4,cFAA M CBF vAE@dFAA X ABE E AME eABT<8FED D(G0K (L ABBJ KEElFEE H(D0A8G@nHHPJXB`BhBpAxBBBI@x 8C0A(B BBBB pFBD A(D0 (C ABBA x (C ABBH g (C ABBI ^ (F CBBE (EP K  F  E $\E_ L k4DEAD D CAF v CAF 4|EFD L CAA j CAB h&H](̈HY G F B v J Qd$FBB B(A0A8GPMXM`\XAPD 8C0A(B BBBD yXH`cXAP(`|AEDDP AAG 8FAA g ABF y ABD ȉT9Hn|FBB B(A0A8GpUxHQKNpc 8A0A(B BBBG kxXMHGBQpDxHcxApzxIfxApwxKexBp\ FBB B(A0D8DpxKWGIpW 8F0A(B BBBH X8$FBB A(A0` (A EBBJ [8N@KHMPI0D(A BBB(@$EDD e DAI (l0%Ew D i G t D H&FBA A(G` (A ABBF hLp^hA`8X*FLD H ABG I MBH  *2Ea < +~PxHHe@`|+EDQ Y AAK ^ FAK ^ FAK ,alo`,fЌ,IT] G P<,FAA J08K@O8A0Z  AABE `0.FJA D(F0Q (A ABBF i8N@\8C0c8N@\8A0F(A ABB(/;FBE E(D0A8GLZBFLE 8A0A(B BBBF N\D MW $6l<6BGJ G(A0A8J  I e H  8A0A(B BBBI y H ` A  =BBB A(A0G I! 0A(A BBBI _!T!O!B!P!T!O!A!\!O!W!A!U !O!I 4(?EEP\?oh@QEKX@qwo@(@CXďAFEB E(G0H8J 8A0A(B BBBC |K^CX B-FBE L(D0A8Gp 8A0A(B BBBJ xM^xAp@|FEDQ Y AAK ^ FAK C FAF H,GFHD D(L0 (C ABBI g(C ABB0 HDq K BR TAF A BN (@FHC iAB(L>FHC iAB<LlEAD N CAD P(F0i(A IAA0LEDG } FAD KCA$(TM2EDD `CA4PlMYFAA z ABK CCBM M4MjFDH J ABA CDBMEHQ kN!L$N_ERD | AAG G CAE h CAD c(M0\(C Hh4OWFBB B(A0D8F` 8D0A(B BBBI @HUECG n AAA l(M0\(C w CAE @VECG j AAE ](R0Y(C t CAE <VWljTWpaa F g(thWsEKG k AAD 4WEID  DAG Z DAA ؖXFEH B(A0D8GP^ 8D0A(B BBBD LXH`bXDPiX^`SXBP^XF`iXBPXE`IXAPXXP`^XAP\ XM`L DXI`t\' \$<\'X\%ȗt\EPx\FJI B(D0A8L^SBOU[A_[Bg 8A0A(B BBBA mbWBoFNAHKMHPS PJ l`FEA D(QP (A ABBG u XP`K TXM`\XAPN XP`L TXM`_XAPc XP`G 4biEMG i GHO { CAA ,LcyFOM  HRP @|@eFDD E ABJ g ABF dAB@eYFBB A(D0GL 0A(A BBBF (fVAID [ DAB H0 gFBB E(A0D8G` 8A0A(B BBBD d|gzFEE E(A0A8G` 8M0D(B BBBG  8D0A(B BBBE 0kjENI M CAC uCA(4lEND r DAB Dl8\PmnBBB A(A0^(A BBBm8FAA G L@I@@K@`@B@`  AABG Q@M@Y@A@@H@]@K@I@K@M@Y@A@N@L@K@C@P@\0,pFBB A(A0G L@I@ 0A(A BBBF P@M@T@B@Y@T @M@T@H@G @ @H@O@I@H Z@M@R@Q@I@^@M@T@O@I@@H@H@H@W@P@I@O@O@W@M @H@H@H@E H@K@P@H@W@j @F@H@A@E f @D@H@A@J [ @H@H@A@E Y @F@H@H@E Y@F@H@H@@tEG W AD P(M0T8T@K X(M0T8P@I ԝxuFOG B(D0D8GMTA{IOJNr 8A0A(B BBBF xO^Dgx\wFDA Jw  AABH DL^AgPKAsHOJNyMOCN؞xXKG A (yvEIt AE ly4EAD  DAK e(I0O8A@\ G AAE f(M0O8C@N a MOP e (F0O8A@M T{FHE D(D0D`h_pHhF`H 0A(A BBBD JhMpOxCN`GhMpTxCP`khMpTxDI`H }KEL\Pt AAE PXM`ThPpIPXXH`ThRpIP,X~ED G fM O(C0NF4 L0uAN_U AAK tTOA_TOAx`BBB B(H0A8DPXT`MXAPbXR`OXAPL 8C0A(B BBBH D8F0A(B BBBhaBLB E(I0C8QlGPBTOA 8A0A(B BBBK cTOAtMOCNsMOCP,|KAC DEED H @ TFEF B(A0D8DPE 8D0A(B BBBB XJ`QXAP[ 8F0A(B BBBE XK`HXFPXc`IXBP,+E_@ < $8IKQ D hDh Xd l` \ X T P УL H D P  L 4HHT H\PEGF m MHL Q OJF D AAJ IPC \Ф\ X T\   4 H\ p     ԥ    $ 8 L `| tx t p l Ħh ئd `l h (d <` P\ dX xT P L H ȧD ܧ@ < 8 0!0L3OULLp`lBFB B(A0A8GTMBu 8A0A(B BBBD sTLA~TOAgRPBK\nċ9Ha G Dl<FBB B(A0A8G  8A0A(B BBBH UROApLKAHp EG~ AE HMTHWX MTHB ,DHW A e K PM T(T0K(Ď)E]8D؎JAD { AAD L DAO oH P H,\|\FEB B(A0A8D@Y 8F0A(B BBBC p8C0A(B BBB ]HV B j F I]G,]EID e DAD D(^X4^ l0^<^RE[ H i|^NE] F _ ^EZ A H_BEE E(D0C8DP 8D0A(B BBBD |0aBEB B(D0F8D_LEKSKTAH 8A0A(B BBBD  GQ p\iBEH B(D0D8NBBBI^RUB| 8A0A(B BBBI ($nAADO AAI HPo9BJD D(D0m (F ABBH (C ABBpFBB B(A0D8GuMOCN 8A0A(B BBBI KPYAjIOA\X MTCNwKHAE C_IBACNlM\A[_IBACN(twDP]XD`GhApLPh G $w\p D QN YJ`xRBLE B(G0A8G_bBN\HBB]T 8A0A(B BBBH tIBB]t8zBEE E(D0D8DpTxPBBIpC 8A0A(B BBBE MxHBGNpxxZBGNp{?A] B P{]Al K dH8{BEE E(D0D8FPa 8C0A(B BBBD |NBBB E(D0D8NMJFL| 8A0A(B BBBC IeDbMA,dACE K(A0NA D r88BHD G(D0B (D ABBD 4thFDD z AFQ C ABJ FJB B(A0A8JSDDAND 8A0A(B BBBH |BKYNBKYI~IEaMcAL^AvBKYIirTBGKHQ rE  FGEYPM ]P]BNMMI SM % SJ  PJ Y PJ  SJ J PJ IMQHILTFHM N(A0M(F n(L0`(A K ABJ vABXFKJ A(D0B8B@BHAPK0D (C ABBB g(C ABBX.FEE E(A0D8GPGXM`JhDpMPV 8C0A(B BBBF t\ЕxFBB B(A0A8JAGMBN 8A0A(B BBBC ZHLBNXؗFBB A(D0e8M@PHGPI0Y (A BBBG d(A BBBT0|BBB D(G0G@ 0F(A BBBE e 0C(A BBBA T4"BBB B(D0D8JrN`A 8A0A(B BBBG N\AHBBSPUATDE`DNBE[QBEVyP\AP]BBBBNpHIBSIJFVCN]B QJ BBB B(A0A8G L" 8A0A(B BBBE e"G"B"A"S"I"T"O"A""]"J"G"I""c"K"A""I"O"J"N"J"b"T"E"-BBB E(D0A8JcLMGI} 8A0A(B BBBC GEDIN`DRHXJNLVZBy WB L\ BBB E(D0D8G 8A0A(B BBBH \1 BBH E(D0A8JhiVB 8A0A(B BBBE ` FBE B(A0A8JRHLBI' 8A0A(B BBBC <p FJE K(A0J (A BBBF   |\FEE A(D0a8K@OHBPI0R (A BBBD ~ (A BBBC d (A BBBE d(A BBBXX t[FEB B(A0G8G`whGpwxDV`O 8C0A(B BBBH p xFBE E(G0D8DkHLBIz 8A0A(B BBBA zMbA`( fFGD f(K0K8B@I C ABB  ABA T ABI f ABG P FDG l(K0K8B@I  ABH t ABA t ABI p  FBE H(D0D8DLHLBIz 8A0A(B BBBH MbApT FBE E(I0D8FdGLBIz 8A0A(B BBBE zMbA DyFBE E(I0D8FdGLBIz 8A0A(B BBBE zMbAHiApL @FEH D(A0GHLBIz 0A(A BBBA M`AS MO p lFBE E(D0I8F|ABBIz 8A0A(B BBBE cMbA@4 jFCA G`yhHpLxBI`  AABD x  FBB B(A0A8GMJFSfJTB 8A0A(B BBBE bMAX 0FJD D(D0f (H ABBA g (C ABBA e(C ABB4XbFDD _ ABH fAB ERP@ AH (WG^ K fDhFBD D(D` (A ABBG shNp\hA` 4 AZ(P 1BGA cABT| gAI]p AAG bHTQNMMQN8:TO E NX#BBB E(D0D8JYLeAV 8A0A(B BBBH HTQNHRPBqROAfMMQNMTBU MB XBJN K(L0w (M ABBF h (C ABBH h(C ABB`TPBBB D(D0` (A BBBK  (C BBBH 8M@MHQPQ0\|@ BEE B(D0D8FHSPAX 8A0A(B BBBF  >Hl I AHo I +HH Z0 FEE E(A0D8D@nHKPNHA@D 8A0A(B BBBD DHPPMHB@LHhPFHA@I8A0D(B BBBDh FAA J ABK j(X0F(D \ ABE    $84L yAOG  EDM (M0\(A haBEE L(D0D8DuKMOHFDDIvKKDIULKDITDDFFFNMDDDIDDDDIc 8A0A(B BBBK tODDI@LNDIN_A  0mH`P H \h_pDxDDAY`:TF F(F0StmFAA B(G0o(D K DBK j(M0Y(D q CBF D(M0Y(E N ABH (M0Y(D  FBB B(A0A8DeC\DPIMDImKKDIdDDFFFNWDDDIDGDDAKKDIp 8A0A(B BBBG ZNeA8BBE A(D0GQDDIZDDFFFMDDDD\h 0A(A BBBA DODDIrHDDI8$BBB B(A0A8G L"B"z"C"B"]""O"P"D""N"\"D"[ 8A0A(B BBBG a"N"\"B"0\!_ADI P CAF rCAT!9BBB B(A0A8D@| 8C0A(B BBBJ IHKP`HA@p\p#BBA A(DpF (A ABBJ rxGODAHIprxDDDIpQxT`xApp$6BBA A(DpD (A ABBD rxGODAHIpexT^xApDxDDDIpDX%5BEB D(D0DplxNHHNp_xDDDIpZ 0A(A BBBE wxTYxAp xSQ d xSQ @ (fBDD T ABG J(]0O(C AAB@8(BDD u ABF J(]0O(C AAB@X(fBDD T ABG J(]0O(C AAB((KDDD tHB(BFB B(A0H8D@HMPfHA@L 8A0A(B BBBD j 8A0A(B BBBL m 8I0A(B BBBE hP)BBE B(A0A8DmLIAHHKANAMAIAHAAw[WKFDAINDDDIf 8A0A(B BBBD _gAHHMAIAHAAqSMhADDDDIrDDAWT XOIAHAAn[RDAE \0-BLO H(JCKAe (A ABBB lFcCp. 0l. Dh. Xd.Ht D 8x/H`N J zhIpDxDDAY`U J 0JdF F(F0S\05FBA A(Dh (A ABBD cI[AjDDDI41SFBB B(D0G8GS 8A0A(B BBBE (MOIAIAINDDDISTYAPKFH$\8mEo L A G O,8FFE H(D0D8LxbHBYCNHFHIAIAAAMPjDDDI` 8A0A(B BBBE MHNHMHIABAIHNNENAK[Av PL T PL D PL d8 =FGD I`lhHpYhA`BhHp`hB`WhDpDxDI`Z  AABB PhMpbhA`8 ?@EAD`~ AAF |hDpDxDI`` @(FBB B(D0A8D`W 8A0A(B BBBJ hJpNxBABI`d@!|D>FBB B(A0A8D`?hHpHxIABI` 8A0A(B BBBE !TJFBE H(G0D8G`hMp^hG`UhMpYhA`BhDpJxNABI`r 8A0A(B BBBC KhMp_hA`hMp]hB`JhIpchA`I hNpI PX"OFAD I`UhNpHxHI`_hDpDxDI`V  AABB "`P FBB B(A0A8GMeBsDMPHIAKAIADAHSGGGIQ 8A0A(B BBBE RTBPTBp0hPBxDDDDDNT SR iMGGIEGIDDDNLO`AB^AQN`AYS_AU LS IIuAISZBI LS ^ LS U NQ |$YFEE D(D08B@N8A0C (A BBBF X (A BBBI X8j@I8D0A (A BBBI } 8S c8[@W8B0 8W X 8[@M H8f@H8A0] 8[@E `0%\FBB B(A0A8G I! 8A0A(B BBBA !c!O!A!%H_FIB H(A0L8L~ 8A0A(B BBBF ^YJIAIAKAHS`DDDMNdAI NP @&aFEE D(D0 (A BBBF i (A BBBH L8E@l8A0A 8J@U v 8J@X Z8E@l8B0I 8J@U D8J@&eFBE E(D0D8GBMTHIAIADAHIUDDDI] 8A0A(B BBBJ d'fSFBB B(G0D8FGODAIIfDDDI 8A0A(B BBBG TDDDI8'dhEAF`hDpDxDI`[ AAJ $4((jUAJHC\\(jBBB I(A0A8D@k 8C0A(B BBBD HHTP[HA@PHTPl(Pk[FBE D(D0DpxKCIAIIp[xDDDIpa 0A(A BBBF ,)@nFBB G(D0DpxBMPHCIpexDDDNp 0A(A BBBI txDDDNpP)\pEAD`ghHpFxOHHK`_hDpDxDI`g AAJ *q *q ,*q@*qEP\*q'p*q**q%*q#*r#8*,rFBA D(Q@ (A ABBG P*sFIH A(G08[@8D08T@S8D0(H DGKlP+,wFEA D(G0 (G DBBK e (D ABBB e (D ABBB h(D ABB+Lx+XxRE[ H iX+xFDD D@c  AABG H[PVHB@HOPVHA@}H_PCXF`K@\P,\{vFBA A(D0 (C ABBE j (C ABBF g (C ABBA 0,||BDD G0y  AABB L,|lFBB D(K0 (A BBBA n (A BBBK D4-FAA c ABB d ABI i ABD D|-ЂFKD  ABI f ABG $ ABI |-xFJJ A(A08C@l8D0K (A BBBE p (D BBBF j (D BBBD b(D BBBD.ȊHX.ԊBEE E(A0D8I@C 8A0F(B BBBG @.BJB A(A0G 0A(A BBBE @.BJB A(A0D 0A(A BBBA ,/ \@/&BEE E(G0D8F@ 8A0A(B BBBA D8O0A(B BBB/M_mH/BEE H(F0w (A BBBH h(G BBB@0HBGE A(A0G 0A(A BBBF LH0_BGB B(D0A8G 8A0A(B BBBD 0D0UBJE A(H0J# 0A(A BBBA X0BGB B(A0A8DRaCX 8A0A(B BBBE <P1\BJE D(G0 (A BBBF L1BBB B(I0A8G= 8A0A(B BBBH 81|BFA D(G` (A ABBF \2ЗBBB B(A0A8DpOxPJFSpT 8A0A(B BBBA L|20BHA D(Jw (D ABBG ^ (A ABBD H2BBB B(A0A8Dp/ 8A0A(B BBBI \3DFBH B(D0F8D@s 8C0A(B BBBA H8A0A(B BBB`x3FBB B(D0A8D@g 8C0A(B BBBH t 8D0A(B BBBA 3М$AZ E CH3FBB B(A0A8D8A0A(B BBBH4\4 nFBB B(A0A8G L2 8A0A(B BBBB 2`2J2A22P2M2C2S22\2T2K2Y22P2M2C2S25\58H(5D: FEB B(A0A8G`/ 8F0A(B BBBJ Ht58FIB B(A0A8DP 8H0A(B BBBK d5SDB B(A0A8D`I 8A0A(B BBBA 8H0A(B BBB (6E E XL6BBA A(D0u (G CBBK e (D ABBJ D(G DBB46dBDD e ABF YCBL6 FGJ B(A0A8G 8A0A(B BBBJ 07 D7 \7HNLt7ADG V(O0[(A Z FAB L(I0`(A F AAB 87,FGD I(D0k (C ABBG 8EM808D84X8EFAG J  AABK D8LFFA p CBF e ADF j ADI 8BJD A(G0z (C ABBF G8W@H8C0b (F CBBH g (C ABBA U (C ABBC s (C ABBE l9`^AS D Q G L9FBB B(A0A8G;M`B_HhA 8A0A(B BBBA k MN aHcAUHiBH_DFhIBiAUBN]B[ PJ I`AJ MJ  XE P XE  DM cK^Am ZH (:vFGD g ABE 4 ;pmFGD Q ABK yAB4D;mFGD Q ABK yAB0|;BID GPl  AABJ (;hAIGP AAG 4;!EDJ v AAE [ FAF (<EIG r AAG @@<LEMG o CAD c HAD c HAD l<FKE B(A0A8Gpx`LNTp0 8A0A(B BBBB YxM\xApd<FKB E(A0A8D`' 8A0A(B BBBA  8F0A(B BBBF 8\= FDH W(U0_8B@I A ABD = /HM N(B0I= /HM N(B0I8= FDH W(V0X8B@I A ABJ \>H FGI A(G0[8M@NHKPI0K (C ABBE E (J ABBL Tt> FNM D(D8A@HHBPI0K (C ABBH v(G DBB|>0 qFBA A(D0s8c@HHBPI0K (C ABBF { (J ABBF J (C ABBF e(J ABBhL?0 )FEI A(G0T8V@UHBPI0K (C ABBG W (J ABBJ e(J ABB? AHh P?( ?$FAv I AL@TBIB A(A0o (D BBBH f(A EBB8X@BBD D(D0f (D ABBA L@BJA A(D0 (D ABBB i (D ABBA `@hUBEE B(D0D8DP 8C0A(B BBBD  8D0D(H BBBJ HAd BBB B(A0A8G L@LB 8A0A(B BBBH BNB\BBB%BNBKBABBHBKBEBIBdABBB B(A0A8G L@LB 8A0A(B BBBF BNBKBAB8@B$RBLA D(G (A ABBB |B &FBB B(D0A8D`2 8A0A(B BBBG s 8F0A(B BBBF f 8F0A(B BBBK c 8F0A(B BBBA e 8F0A(B BBBA X,C(bFBB B(A0D8GP( 8A0A(B BBBF X_`OXAPDC$-5FEA D(D08M@^8A0D (C ABBB lC.FBB B(D0A8JM\AJ 8A0A(B BBBH HKFx@D5BBH B(A0D8D@HMP_HB@D 8D0A(B BBBA i HPPG xHFPIHA@ HFPIHA@D@9HN\DH9BBH B(D0A8JJH^D 8A0A(B BBBE 44ExEIG r FAB jFAHXf?FDH \ ABG (M0J8E@I o ABE fh@ f`@Lfl@ BBD D(D0| (C ABBD v (A ABBD  g,AL4g8BBIB H(D0A8G 8A0A(B BBBA gEBBB B(A0D8D`yhgpMhB`ShPpVhF`q 8A0A(B BBBA e 8F0A(B BBBA f 8C0A(B BBBA k8C0A(B BBB0hFHA D(D0G (C ABBJ E (F CBBF c (F CBBH D8J@e8A0|VFGB G(I0A8JnSOJI\BBNP 8A0A(B BBBJ oMULEEId<}FBB B(A0D8LKPIDBN] 8A0A(B BBBF D}{FDH P(M0K8D@I A ABE bFB} _D0U A H~d1BEB E(D0A8GP 8C0A(B BBBF lT~XBGG B(D0D8DX]`KXBPZXT`[XAPX 8A0A(B BBBD $Xh`HXAP8~BBA D(L0 (D ABBA X FBB I(A0A8DMTAg 8A0A(B BBBE L\@FBB B(A0A8DF 8A0A(B BBBF PbFBA A(D@HSPKHA@Y (A ABBH SHLP`HA@tFEB B(D0D8DpxMTxBp-xFOxApN 8A0A(B BBBG xL`xApxD`FJE E(D0D8Jw 8A0A(B BBBC kH[BYCBIFLEI| FBB E(A0D8M 8A0A(B BBBD  RL MYAGhAdx"FBB E(I0A8G`hMpZhH`}hMpGxBI`f 8A0A(B BBBK H@{BJD F(D@y (A ABBG T(A ABB8tBBE B(A0D8GP{XP`QhIpIPFXO`UXBPBXB`fXAPBXB`eXAPYXP`ZXBPPXI`^XAPJ 8F0A(B BBBD tXI`^XBP\XP`QhIpIPGXP`RXAPBXB`eXBPBXB`fXBPMXN`ZXAPOXL`bXAPQXM`]XAP(4HADG  AAA T`{BBB B(A0A8G L@LAK 8A0A(B BBBB XBBA G(D0@ (A ABBJ D (C ABBD D(G ABB|(, BEB B(A0A8G 8A0A(B BBBC @F[LDCIG`A AG U AB tAG U AB |܄BHE E(I0D8J_MFIFaF 8A0A(B BBBF DMWC\ VTlG NH|`BBB B(A0I8L@9 8D0A(B BBBD ȅ BEB B(A0C8G  N \ B N N \ A Z P _ A } a F F Q c B B Q  F a B P M Z A  S _ B  N I D B B U o 8A0A(B BBBF t N G A S F N G e G e B q S _ A ] O ` B   S Q  [ H E P   N I D B B M D P ] E } M P E P ^ N Z A I P N I I (x#\BKG DAB # BBB J(D0J8NIYCeDeBMYASMZDfEfBIYCfCfBu 8A0A(B BBBC MYCeCeAQMZDfEvACMZCeDeA8-BEE E(D0I8GkOFFNP 8A0A(B BBBE {LFFN\FDDBJX@ FDAF \@/BBB B(A0A8Dp]xVFFWp 8A0A(B BBBD p2cBFB E(A0D8JIII[HFADDOSN 8A0A(B BBBE JMZAcnA\vAIK_BL KI   KT $ԊA*FBB B(A0A8G L&} 8A0A(B BBBH d&H&\&B&z &H&L ~&M&_&A&t&I&I&I&p& &K&U l &E&G F &M&U &I&`&A&&I&I&I&`&P&a&G&G&D&D&I&Z&T&L&A&D&D&I&&I&I&I&^&h&B&I&I&S&@&I&_&B& &R&_&A&I&R&`&B&H&I&`&A&W&I&I&A&B&B&N&|&O&T&A&D&N&g&D& &O&E N&I&I&A&B&B&N&&N&`&B&&O&k&D&s&r&F&H&\jFBE E(A0A8J 8A0A(B BBBH KcF\@oFBB A(G0 (F BBBC I (F BBBK u8F@I8A0}8F@I8D0Z8F@`8G0A (A BBBD I(F BBBDpFDH m ABF >(B0F(A j ABE H<rBEE D(D0\ (E GBBH e(C BBBHsFED G(D0V (C ABBH J(A CBBԎs!sQFEB B(A0D8G 8A0A(B BBBI CO^AEDBNMYAHPB`|FEB B(A0D8GP 8C0A(B BBBE D 8Q0H(G BBBF d FFE I(A0G BFD 0A(A BBBG yGFD@LEDD t AAE p CAD k CAA LGET G fP|FBE G(D0D`MhOpUhA` 0A(A BBBE <FBA A(G (A ABBG \DFBA A(D0\ (A ABBH h (F ABBE c(F ABB\xFBB A(A0GPXA`SXAPcXF`PXAPf 0A(A BBBH ^FGB B(D0D8D}KDACBI] 8A0A(B BBBA  TMMABIpIMON<HAAG L! AAE l!J!`!C!tBAA G I   AABJ U M c B ` T O A K j H B O b H A \X$3BBB E(F0D8G 8A0A(B BBBK TOADFBD G(G0R (F ABBI 8M@\8A0@ܝBFB H(A0D` 0A(A BBBA DXBBB B(A0A8G I!!R!N!A!v 8A0A(B BBBD U!T!`!C![!T!O!A!n!F!R!B!V!b!I!B!|TBBB B(A0A8G I g N b B ` R K D z 8A0A(B BBBH W T O A |hdBBB B(A0A8G L& &F&]&D&I&j&L&N&D&p 8A0A(B BBBH D&E&T&C&_ &N&S I&h&I&C&&G&E&D&D&A&I&H &Q&S f&O&T&G&@ &B&F c&K&[&D&I&`&M&J&A&W&] &O&O Q &Y&B&A&K P&b&D&A&I&]&N&N&L&D&D&I&c&b&H&A&V &M&L&A&E ԦBBB B(A0A8G L""D"@"E""O"U"A"x"L"b"A"c 8A0A(B BBBG D"M"k"B"V"G"F"A"I"a"_"E"C"P"I"L"i"A"BBB B(A0A8G L##I#^#D#[#{#j#B#}#b#M#B#I 8A0A(B BBBA }#P#Y#A#H#U#B#E#\#B #N#I#A#G I#K#P#M#I#V#N#Q#K#A#A#I#lBBB B(A0A8G L!!T"O!E!C!R"O!A!X!L"_!B!X 8A0A(B BBBE G!T"O!A!j!R"P!A!DxBFB B(D0A8JH_CXK]AM\BC 8A0A(B BBBD H_BH^AH_BsI^AH^AY KL bLMAKLND\ KT QI^AV MT A KT ZI^Bn_GBI KL QH^BX KL PIcBxܚFFB E(I0A8GAIA}KGGBBNf 8A0A(B BBBE LX4EAG I  AAK \ T O A L M ` A 5BBB B(A0A8G L@LACBMAHAPAPBIABAoATBPABAATBOAAApATBOAAAZ 8A0A(B BBBA DAMB`ABA\FBJ E(A0A8J 8A0A(B BBBB *I^A2^OAL^PBN^OAJ^PB9H^A{MIBI8I^AkI^A`LB_GUB^ LS a LS nFHApMHBwFIAhFPBWUA LL PRAlNUB[`MAZPRBU GE U GE kPHAP\AHh PlО4RFDI i ABI AFB4RFDI i ABI AFB4TRFDI i ABI AFB4RFDI i ABI AFB@ğ8mJAG e AAG  AAG rF `dwBBB F(A0A8D` 8A0A(B BBBH m 8C0A(B BBBA <lFsK J(F0Pp D YF kCA J (HYJ B(B0IO I x(ؠT{HRI F(B0IO E pHBEE E(D0D8I@d 8C0A(B BBBF 0Pl BDD D0q  AABE LHBHD A(QtKFBIw (A ABBC ԡ\$(BEJ E(D0A8J{KDBIz 8A0A(B BBBB `Ԣ~BLL I(A0D8G K J G A I z 8A0A(B BBBG 8#HH RT#HK Op HH O&HK R,$EVJ E(B0IR I u<أDF N _ I WI LAD G j F N J @$NBBE A(A0GP 0A(A BBBI L\0GBJG E(A0A8G 8A0A(B BBBE 0BEE B(D0D8DpexYCDEEEEIp 8A0A(B BBBK xKJAIpXxAQxApP xL pxHJGIpV xI a xL Td 3BLE A(A0J 0A(A BBBH D[EBI<=FEE D(A0x (C BBBJ HLFBJ E(D0D8G 8A0A(B BBBA H(\9FDH TAD(TFDH lADȦܦxFIE A(A0JGGEEEHHi 0A(A BBBA mIeA$lED h AF HNHNħ&E`H BJB I(A0K8D@r 8D0A(B BBBJ L,BBB E(A0A8G 8A0A(B BBBA \|BEB B(A0A8G 8A0A(B BBBH aOYDܨBEE E(D0A8F@ 8A0A(B BBBE : 8C0A(B BBBJ y 8F0A(B BBBH HMPMXF`N@lHNP[HF@HxD!KBBB E(D0D8D` 8A0A(B BBBH HĩH$BBB E(D0D8D` 8A0A(E BBBI D'BBH E(D0C8F@a8A0A(B BBBX( l(MBOE B(A0A8G`xhKpehE`hMp]hB`h 8A0A(B BBBB hKp[hA`hZpIhE`[hMpYhB``hJp\hC`thUpYhA`\-JFNR G  AABD RHHMrQHHKHt0 FBB E(D0A8Qp{ 8A0A(B BBBF Hl2BEG E(A0A8D@x 8D0A(B BBBB 0 @3AKD t DAG kCAH@3FII B(D0D8G 8A0A(B BBBC H5 FBB I(D0A8DP 8C0A(B BBBA 4ج5NDO c DAG @H (L6QFG K AAE \<78FBB D(I0G@ 0A(A BBBF wHLP[HA@HNPYHA@dWZ@(BDD g CBJ z(I0](A CCB AZP$BEL D(D0D@b 0A(A BBBG PHMPOXC`K@xBBB B(A0A8G L"z 8A0A(B BBBG <"T"L"A"T"T"L"A"~"I"O"J"K"@"T"M"B"P"D"_"B"\$[BNA H0S8P@R8F0X  AABH f8G@Q8C0a 8O@O U 8G@B HAGL M(M0a(A I AAE f(O0H(A FAA|BBG L(A0A8DPXR`tXBPbXN`[XCP 8A0A(B BBBK XK`\XEPlXO`IXAP0PBAA DP|  AABH \ACI R(F0a(C D AAA M(F0Q(A F AAC D (N0N D(N0(BAA w ABB ( AIJ P CAH H<BAA G I ]  AABK x M O C L d4"BBB B(D0F8D`8 8F0A(B BBBC  8C0A(B BBBG EW A qD$88DDL `|tAr0 ,( 4$EMD  DAF s DAH @ sFAF H ABH b(F0c(C AAB`THpFBB B(A0A8D`6 8A0A(B BBBF thKpehA`W hKpN \TFBBE B(D0D8J 8A0A(B BBBG MSADBBB B(A0A8G L@LDi 8A0A(B BBBD DTDLDADDMDMDQDLDDDRDMDAD\ BEE D(D0y (A BBBD } (A BBBD F(A BBBl ;FBB B(A0A8GE 8A0A(B BBBD SUZANUZALx BBA A(G0D (D ABBF m (D ABBJ 0T ]EIJ N KAN INA (| EAG_ AAB (<EAG_ AAB h(|EAG_ AAB (EAG_ AAB L^FEA A(J{ (A ABBH HMAT$7FBB D(A0JNSAR 0A(A BBBG |    $xEr I N B gD0EDD@^HPP`HA@{HIPTXJ`R@b AAD DxEDD@QHPP`HA@J AAE zHMPOXC`R@<TT$'FBE B(A0A8Gpy 8A0A(B BBBE wx`PxApkxTLxApx^NBRpqxRMxBpyxMOCVpxTMxBpCxMPQKp(9HEE I(B0A8B@X(*HGC D(B0A8G@I(4HMF J(B0A8B@I(FMIL B(D0H8B@I@T h.| $ EB I ^ B i sFBB B(A0A8H Q G9 8A0A(B BBBG aEAE^~MTTHjK^OHaTLAHFBE B(A0A8D`M 8D0A(B BBBA hMpOxCO`hTpNhB`hApHxHg`QhMpOxCL`GhMpOxCQ`ZhTpNhB`bhApHxHf`F hApHxL AhApHx`TX%BBB B(A0A8G I g I U F P Z 8A0A(B BBBA %8_X<%BEAG L!| AAI m!T!L!C! '`FBB B(A0A8G L@LB 8A0A(B BBBG 9BTBMBDBfBTBLBABxBTBLBBB0)EID { CAG |CA4P*FDI z ABH [AB*EN *RH_ I d< +VBAA F@@  AABB oHlPGHA@HMPaHB@vHOPHHA@~HOPIHD@-bt- p-:TO E Nt-@BBB B(A0A8G L" 8A0A(B BBBG "P"P"C"j"M"O"C"N"<dX0nBBA A(G L!x (A ABBI 1BBB B(A0A8G L@LC} 8A0A(B BBBH CLC\CAC@CNC_CDC`CGC^CBCcCLC\CDC|CMCOCCCPCP|4FIB B(A0A8DLULG 8A0A(B BBBF dOMAONZBTLBhTMAHOCLDRMAuKOQP 0<9dEG x AK T9aFFB B(D0D8FG}OY 8A0A(B BBBG fGRKRNCAFBBBBBHDDDDBHFHFFAAHXR GK 48>EAD0s AAA d8F@a8A0 p>OED } CA ,>{EDD0R AAG $8?BACG qDA8`?BJD Q(F0^(A D ABC <(?sAJG Z(M0^(A G AAG HAA(h@{AM [ AF IA`h@BBB B(A0D8D@ 8A0A(B BBBG n 8A0A(B BBBH @$DBBA A(G L"h (A ABBI $<FPAC C B 0d(HQAAG t FAD DCA0THBDD I  AABA (IBDI } ABA 4IqBDA n ABH mABX0 J/BBE E(A0A8GPi 8D0A(B BBBC XE`\XAPKXHPJ A 0$LFAA D`o  AABA @LAAG w DAK G(Y0[(A G AAK d  M=BFA s(P0g(A D ABE z (P0N  (P0R N (P0R  (P0Q K (P0U tPBBB D(A0G@UHPPeHA@D 0D(A BBBD f HPPR | HPPT U HPPS S HPPU H,UBEE J(D0D8D 8A0A(B BBBE LVCAA8hVBIA D ABE A CBB ,HWAC M D @]BJL D(D0G`g 0A(A BBBJ H]AJF Z(M0^(A F AAA H CAL NAA0d^FFA G`g  AABA @^VBBB A(A0D@ 0A(A BBBG 4_EMD j DAK o DAD X` (T` <P` PL`#dh` xd`p`4|`EDD m DAA j DAA `a aa($a<0aPY/BBB J(K0D8G 8A0A(B BBBF HXH JJ EjB EM pLcBpEA LT \ KT @(mBEE F(D0D@ 0A(A BBBK @(@nmBEB D(D0D@ 0A(A BBBC  )lp[Ea J j@)p T)pXh)p FJA D(D0l (A ABBE m (C ABBK p(C ABB)xqX)tq FJA D(D0o (A ABBB m (C ABBK p(C ABBX4*(r FJA D(D0l (A ABBE m (C ABBK p(C ABBX*r FJA D(D0l (A ABBE m (C ABBK p(C ABB*sW+s>EtL+t{FBE B(D0D8G 8A0A(B BBBJ l+0y[Eb I j+pyT+lyxFEB B(A0A8D`hTpWhH`n 8A0A(B BBBD +z< ,zECF W AAI D DAG LDA`L,{?FJB D(D0 (F BBBE v (C BBBI S (F BBBA ,{(,|EG P AK XC,|4-|FCD  ABE kABx<-}|FLB D(A0N8D@M8A0^ (D BBBG 8K@e8A0b (D BBBD  (A BBBF -6LL H I-HRX-X FBB B(A0A8G`_ 8D0A(B BBBG hKpWhA`|P.SBBB B(A0A8D`N 8A0A(B BBBJ J 8F0A(B BBBG  8D0A(B BBBE .̍.ȍ .č D /FPA Z ABD o ABF w ABF T/OBD I(G0 (A ABBC ~ (C ABBJ H0m (C ABBA 8[@U8A0L8[@U8A0P/ SDD F(v0F(A Z(v0F(A OAAJH mCA\40HAFFD A(D0{ (C ABBH j (C ABBF `(C ABB$086EFD bCA0PaH0FBB B(A0C8D@ 8C0A(B BBBA D1IJD O FBB j CBA q CBJ d1ȕEJ AA 1"EXH14FBE B(A0A8Gp 8A0A(B BBBC 1K A  203 2\VL42NFGE D(D0w (D BBBE l8N@SHMPG0T2FEE A(G0Q8N@W8A0A (D BBBF h8J@`8A02PT2303EEGI S CAD PCA8L3МFED D(GP (A ABBJ p3FHB E(D0K8GIbAa 8A0A(B BBBA LdB3;IpAL4FBA A(D0 (F ABBC o (A ABBK lh44FBB B(D0A8G`hMpWhA`f 8A0A(B BBBC hLpZhB`zhMpWhD`p4FBE B(D0I8D`X 8A0A(B BBBF ]hIpIxILEEEEEK`XL5FEI D(D0~ (F ABBK { (C ABBE j(C ABB@5T'FEB I(D0DP 0A(A BBBE 45@ EED0\ AAD `8I@S8A0X$6FED I(D0k (A CBBA o (C ABBI u(C ABBL6FED I(D0l (A ABBB M (C ABBK H6L[FBB J(A0D8D 8A0A(B BBBJ 7`SE[ H jH<7LDL RCAFH Z(M0T8T@[ DAA7070.7L 7H ,7@BDD B ABA 8 8FIA g ABA K(G0a(A $H8$_EDD HDA,p8\FAC j DBF 848FAA F HZP HAB8@;9lw|]F8 9FBD D(G0 (C ABBH \9%p9(9FFGD nDB49ܽ`FHD D(D0|(D ABB9*EdT:FIA A(D0g8F@b8A0Y (C HGNR D(H ABB\:оp:̾H H hH:@FBA A(D0 (D ABBF f(D ABB0:NAAD o CAG ICA0;KADG c AAG PAA(D;ADG L AAF $p;pBAA  ABF  ABK  ABA 4>BAA Z ABG  ABF H$?BBB B(A0D8Dp 8A0A(B BBBK @p?WFJB D(D0D@ 0A(A BBBG $?-EGG IKA?d`?\FEE B(D0A8H@ 8C0A(B BBBE d 8F0A(B BBBA ,T@XFID X ABB @Ht@@P4@cFAD B CBA CJB(@JFDG sAAA($A(?FDG gAAAPA<G A HlABEB E(D0D8DPB 8D0A(B BBBG ATkLAFBE B(G0A8GP 8A0A(B BBBG B EDG r(K0Z(D _(L0\(C \(L0\(C \(K0[(A P(U0X(D V(I0\(D \(I0\(C V(I0\(C N(U0X(A P(U0X(D N(U0W(D q(J0d(C D AAD e(N0[(D Z(H0\(C BcHC$BEB B(A0A8DPv 8D0A(B BBBA 4TCxCBED F(D0d(D ABB(C?BDC rABDCBKE B(D0A8GP|8D0A(B BBB(D EFK A DAD ,D%E[HD<Pk``DFBE B(D0C8L@o 8A0A(B BBBE o 8A0A(B BBBG D8@Ez$D\,EGG IGD(Ed.FDG RDB$4Eh,EGG IGDH\Ep{FEE D(G0F (E BBBD A(C BBB4EWFED G(G0s(A ABB4EaFED D(J0}(A ABB\FFEE E(A0A8JP| 8A0A(B BBBI D8C0A(B BBBxFt4FpVFED D(D0x(A ABBF?EyF F G4G;4G HGAb\G@;\pGl$Gx)EGG IGAG G|Gx GtEUHxEV H|EV  vdo_saving_percentVDOSaving%  writecache_total_blocksWCacheTotalBlocks3  writecache_free_blocksWCacheFreeBlocks3 ؐ writecache_writeback_blocksWCacheWritebackBlocksP3  writecache_errorWCacheErrors3  lv_attrAttrA pv_fmtFmtP[ &pv_uuidPV UUID? @dev_sizeDevSize 0 pv_namePV !pv_majorMaj@ 'pv_minorMin <@ pv_mda_freePMdaFreep `@ pv_mda_sizePMdaSize  pv_ext_vsnPExtVsn0A Q@ pe_start1st PE@ @@pv_sizePSize n@@pv_freePFree @@pv_usedUsed P@pv_attrAttr@ @ pv_allocatableAllocatable @ pv_exportedExported @ pv_missingMissing ج@ pv_pe_countPEP @ pv_pe_alloc_countAllocP 0@pv_tagsPV TagsZ f@ pv_mda_count#PMda `@ pv_mda_used_count#PMdaUse @@pv_ba_startBA Start@ @@pv_ba_sizeBA Size@ @ pv_in_usePInUse @ pv_duplicateDuplicate H@pv_device_idDeviceIDP@ @ pv_device_id_typeDeviceIDType? pvg_fmtFmtZ h&vg_uuidVG UUID ? vg_nameVG !vg_attrAttr>  vg_permissionsVPerms  vg_extendableExtendable` ʑ vg_exportedExported   vg_autoactivationAutoActp  vg_partialPartial`  vg_allocation_policyAllocPol  vg_clusteredClustered & vg_sharedShared >@vg_sizeVSizep @vg_freeVFree vg_sysidSYS IDP  vg_systemidSystem IDP vg_lock_typeLockTypep H vg_lock_argsVLockArgs p@vg_extent_sizeExt  vg_extent_count#ExtP  vg_free_countFreeP ȯ max_lvMaxLVP  max_pvMaxPVP 0 pv_count#PVP S vg_missing_pv_count#PV Missing h lv_count#LV` h snap_count#SN w (vg_seqnoSeqP vg_tagsVG TagsZ fvg_profileVProfile@\ ذ vg_mda_count#VMda  vg_mda_used_count#VMdaUse@ 0@ vg_mda_freeVMdaFreeP `@ vg_mda_sizeVMdaSize  vg_mda_copies#VMdaCps: رsegtypeTypeP:  stripes#Str@  data_stripes#DStr 8@reshape_lenRSize`< h reshape_len_leRSize9  data_copies#Cpy(  data_offsetDOff9 ز new_data_offsetNOff9  parity_chunks#Par 8@8stripe_sizeStripe `@region_sizeRegion @chunk_sizeChunkp  thin_count#Thins6 8discardsDiscards\ x cache_metadata_formatCMFmt02  cache_modeCacheMode д zeroZero  transaction_idTransId2 0 thin_idThId( @seg_startStart  seg_start_peStart @seg_sizeSSize 8@seg_size_peSSize `seg_tagsSeg TagsZ f seg_pe_rangesPE Ranges1  seg_le_rangesLE Ranges 1 seg_metadata_le_rangesMetadata LE Ranges0 PdevicesDevices@0  metadata_devicesMetadata Devs/ seg_monitorMonitorP/  cache_policyCachePolicy# P cache_settingsCacheSettings`  vdo_compressionVDOCompression  vdo_deduplicationVDODeduplicationP  vdo_use_metadata_hintsVDOMetadataHints  vdo_minimum_io_sizeVDOMinimumIOSize; 0@vdo_block_map_cache_sizeVDOBlockMapCacheSize`= X vdo_block_map_era_lengthVDOBlockMapEraLength@(  vdo_use_sparse_indexVDOSparseIndexP @vdo_index_memory_sizeVDOIndexMemorySize_ @ vdo_slab_sizeVDOSlabSizep` й vdo_ack_threadsVDOAckThreads'  vdo_bio_threadsVDOBioThreads`'  vdo_bio_rotationVDOBioRotation& Ғ vdo_cpu_threadsVDOCPUThreads& H vdo_hash_zone_threadsVDOHashZoneThreads&  vdo_logical_threadsVDOLogicalThreads%  vdo_physical_threadsVDOPhysicalThreads0% غ vdo_max_discardVDOMaxDiscard$ vdo_write_policyVDOWritePolicy# @@ vdo_header_sizeVDOHeaderSize@; h pvseg_startStartP  pvseg_sizeSSizeP 0    / 3/ N/ / @k{ { Ɠ ē ˓ Z  PDDDDDD`DpD@D`D DPDD@DD0DD DDDDD`DD@DD DDDDDDDDDDDD`DpD@D`D DPDD@DD0DD DDDDD`DD@DD DDDDDDDDDDDD`DpD D`DDPDD@D`D0D D DDDDDDDDD`DD0DDDDDDDD`DD DpDD`DDPDD@DD0DD D`DD@DD DDDDDDDDDDDD`DD@DD DpDD`DDPDD@DD0D`D D@DDDDIDIDDDDDDDDDpDXW; : nmhCCCEYYGGFFEEDD[[ZZ        PE~~vvuuttG$]HcTmltlxxx•ǕЕו:ە,I,J,DDD\htԾ Ծ"&,049=BF(M(Q4[4_@g@kLtLxXXsd5ide@?mdHloopdramdiskpdevice-mapperymdpdasdxdac960nbdidacciss‘ubdataraidՑdrbdemcpowerޑpower2ޑi2o_blockiseries/vdgnbd aoexvd0vdiskps3diskIvirtblkemmcqblkextfiomtip32xxvtmsskdŒscmbcacheʒnvme@zvolVxDMPܧ6   @Dthin-pool@@Dthin 0  p0 PD0_0 0M 8O 8H8O8&888P 8l8 8 8X 8 P88P 8C8L 88P8(P8$0P8) selectedSelected helpHelpo0 ?Helpo0 helpHelpo0 ?Helpo0;CoL Y P   0  Йz(x)y) -}`@Ё'P$P&Ѕ"P#P!+`,` (P%P@@Pp`)*@2-3.ml01 L a r          CCo`H 7D(,p o *oooX*oo((o05D 0@P`p 0@P`p   0 @ P ` p            0 @ P ` p            0 @ P ` p            0 @ P ` p            0 @ P ` p          0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p>G`U GM J`7 @D@D @D @D0@D0@D@@D@@D0@`P@P @0 P  @ #@> H06+`+0%#B`pD`+0%Ch`cDq CLMDH e  C  c    U$  C B@uD8EEcDpCcD C cD !э C X!b "C !C"H$FDUD""D \XtD# mNF$>D"B$(&ND FP)C? ^D FH*mD  F+Q"D -D"DbD3ޒ  $D $FD $F D F!Z *D x4"D 05#DD5$DYD8%D E F8&!E 9'8E Fp;(LEpDx=)hE0D>*{EKDh?+E3D0@,E-DC- D2D@D.E$PF/EhDG0EKDF1EID0K2FUDpK3FUD@L4NDN5*FF(Q6BF"@MDQ7QFUDT8`FiDqFU9xWiDW:0[UDX[;FD[<\jD\=F 1qDD8]F>FDx]? 1D(^@ pD`_AD`BADx`CFpjD`DFpDcEcYDcFG F8dG GcDeH/G cDeIBG ^GeDeJfG FhKtGpcD@hLGpDiMGFiNGFjOGFpkPGF8lQGFlRH?FmS$HFnT>HF(oUSHFXoVlHFoW}HFpXHF0qYH@FPrZHFr[HFs\HFt]HFPv^H Fw_IFz` F|aID}b1I BID`cNI Dd_I D@eoD (fuIbD`g|I (hf @ Pi;A" FjI @kI xlI (mI XnD * oc pI H qI"cDPr`"hFsr"hFte  huI p ИЍvw (wI  xI yI zId 8{I? p|S }J $ P~J6DxD c 0J FȤ  F*J"@ F;J"@ FNJ MJ SJrJ qJuDvJ8J FJ2DpJ*DFJ*DFJ J JK4DhK @ $K 4K FJK9D@`DDcKKD(vK 'WDKhKFK KcDKK SpDL8YD0)LFh:L]DFFLDF_LDئgL|DtL}DL|DHL  FL L^DLL MdDMX)M @MdDVMhM"`D{M"MdD0M"BcDhM"BDM MlDMN NlD+NPP"B `.P"BaD`JP"BYD@`P cDsPcD7sDS  P PYD@P 9DP P$P H $9DPdKDQKD`dYD+QYDhHQdFfQFQ"D>DQ>D@?D8Q?DQcDXQ QlDQ"B|DQ"B|Dp QD RDx RD (F @ KED 8Rp@  GRED8 = @ XR"D F ]R FhR FrR F* FB H F R RD RsD R D(  ;  #J  D   H  8  R RlDh  C$D  J'D  R  RlD` R S{D8 S SeD  +S h!eD! 9S h!eD" OS XS " hS # # qS # $ S S 0% S % % S H& & S S ' S ' ' S (( h( S S ( T h) ) T * h* S S"* T x+"* T +"8, 2T @TD, GT UTDH- \T jTD- qT TD8. sT TD.  T SD@/  T SD/  T XSD@0  T TD0  T TDX1 UD1 !UD2 9U 2$2 HU 3WD UU 4$(4 fU 85YDX5 J sUDX6 U UF7 J sUF8 M UIDU9 U 9 0 8:"B < U uD= U"BuD0? V|D@uvv0vv ywwDDp0&." 54@4P64QQBpBPBA`;   0 P   PPqpa0Й       J I 0T F O A N L L A `A 0A A noneocpjp @ @ @  ` T `S l` y0       ΃ ك      3 E R \ n     0 P p  Є@ HP ڄ       4 H@ Y k  F xF    … ͅ` K0 ݅   p @     ' 2` >0 F V ^ i  w  ` @   Ȇ ֆ      "  / A T d v    ć ۇ P     0 C Y i w    Ո     S   ` @  @0 @* @2 @: @B @J @Y @e @pP @|p @ @p @P @ @ @̉ @։ @ @ 0  S   ( 6 B T _ t    ` p @  ʊ ي  / 6 0    P ( 0 ;` H@ Z f r JI 0     Ap  0 P | 8 p Ƌ ܧ F  0 P ыp U ً Ռp  P     q .` ?0   K [ G G m  >H   }H H H H H H H I H Ì T ӌ   DoDDDDDD(D(D DhDhDDDDDDD@D@DPDPDVVVVVVnדm .:zb$E} O`|`x`|`x`|`x`|`xZ |Z x|x^Q|^QxeK|eKxg~|g~x|xͬ|ͬx[|[xʔB|ʔBxהޔ|הޔx|x|x | xhX|hXx6|6xf6|f6x-3|-3x:H|:HxM$E} O'H|'HxD|DxR|Rx|x+|+xV|Vxf|fx3|3x|xT|Tx!VW@m o i i `h m pm @h h g p q Pt w @w 0s v r q u q `y А {  y І ` y 0 Py P І y p  Hfi\4pDpD 00P` @0h`xeBYNeBWxeBLbeB0Yju&OB;fB (f@#4i4@0Xf&` @`fxeB Y'{?f KS` ip g@@g@Hhg@@@О|g&`@g&gP h maHhExh h*L7h@f i@opr@Pi.  ": C B sIiB9iB  iB:` j&l 8jy `j@ " j$@/ jva / j&0; k? 0k0D XkpH  I kPa!!e"!kq,!kxH5!~L!U!k!(l&o!v!&!PlpT&TTTTUUTU$#U(UMU*YU,U,8U@ULU`,XU`UjU+uUYU|U.TU .U .[U .;U .U U.UUU$UVV+ V4V=V 'KV`\UV'bVkVV@(VVV(VVVP)VV6Wp)W WV)VVV)WW5WP*W W0WP0AW WW,WWLWP-YWbWwW`-WWW-WWWP.WWW (WX!.X\X"@/"X\*X#.4X]:X$/GXPXaX%/oXyXX&p1XXX'1XXX(2XXX)2 YP]Y*3!Y/Y:Y+3IYTYaY,`3rY|YY-3YYY.p4Yp]Y/5Y]Y0 6Y]Z1!\X!!!!!"")"6"J"Z"p"""""" "" # # 5#F# [#l# ###l#l#lm# $ $4$(mD$b$$$$$$$%%-%>%W%Pmxmmmml%n%%%8n %`n!nn"no#(o%$ &Ho%xoo&o$&'>&o(pT&)m&@p*&&+&`p,pp-pq.Hqxq/&q0qq1r@r2prr3r&4''53'r6(sI'7`'s'8''9'':'Xs;s'<((=.(?(>Z(s?tq(@(8tA`ttBt(C((D((E()F%)7)GN)a)Ht))I)tJu)K))L))M**N3*C*OW*g*P}**Q**R**S*+T+#+U8+I+V^+o+W++X++Y++Z+8u[`u,\,,]0,?,^[,s,_,,`,,a,,b,,c-!-d6-G-eZ-i-f--g--h--i--j..k!.-.l>.K.m^.m.n..o..p..q..r/'/s@/U/tl//u//v//w00x*0=0yS0e0z{00{00|00}00~1%1;1M1^1k111111112 2-2?2M2b2s22222222 3&3;3O3_3u3333333344(494N4_4o4{4444444b44a47(5sS5S5I5ޒ*5=85 K@5 2KL5 \5h5 's5 |5 &E5'5,E52E5\E5K5m55&5D555 66&646C6Q6`6n666666667 &777 M7b7 y77 77 777788.8F8\8q888888899&9:9H9U9i9|9999999 ::/:A:\:v::: ::!::";;#(;-3;=;uE;X;vi;t; x};; hy;; y;;y;;z;;8z; ;#pz; <} < <p~'< =<@Q< \<(e<|<<<ȅ<<`<<<< =%=2= ==Z=j= 0x=====`====8B> >>-*>C>R>._>q>8>>h>>>> (> >?!?(A"'? Ȗ1?#A?O?$\?g?%x?h?&?0Ț?'??(}DX?)?@?*?@+@(*@,:@hH@-a@0x@.@@/@@@0@ A1A-A29ACA3SAaA4mAwA5AХA6AA7AA8AxA9A A:B$Ш B;Bȩ#B<0B;BM=TBfB>pBxB?B@B@BBABBBBBCCCD,CȱEE>C@MCFWCMG_CqCHCCIC0CJC`CKCCLCCMDDND'DO5DADPOD[DmDQDPDRDغDSD@DTDDUD0DVE 0EW)EyJXAEXHYLESEZeE)uE[EE\E E]EE^E C_FF`&F'9FaKF[FbvFFcF FdF FeFFfFXMg G GhG'Gi6G/CGjOG (YGkjG,oDlyGGmG@GnGGoGGGpG`HqHPHr%H.Hs?HNHt]HjHu{HHvHHwHHxHXHyIIz. !I{2IP6M|AI+NI}ZIpdI~qI|II III@II@QI"HIJXJJ,J8JBJMJVJfJtJJJJxJJ!JJJJHJ KKK$K0K `:KJKLPXKbKKK&KKKKXKKKL,LBL8VLeL`rLLML`ZML*LLLLLLLMM$M 2MEM+VMjM*|MMMMMMMN(N2NK:N(KNaXNcNakN qNAN NANNbNNnNNbO@OcO)Oc7OCOcMOUOCaO kOCzOOdOOeO@OEOvDfOpOf}D?fO'BhOO.JH<8)DHPP?Pi'P0Pi=PHPiXPfPi.  rPI;  PlPPlPPlPTlP%PlP Qs<LQ'#QM2Q)?QjIQ)QQkgQ(*{QKQ+QmQ+}BmQ,QMQ p3NnQ4QnQ5RnR5"Rn.R8RoDR5NROWR9^RpuR :RpR:RPR8;RPRRqR <RrS%< SrSH=$SR.S6SRK =ESs\S(>BsqSA|SsSHSsSSSSHStSJBTSKSSLSuSNSuSO TUT#TvmDXQRV/T=TVMTQ[TWnT`TTxTWTxTWTywD XTZTXT-p@p@0llGGGG G G0G0G@G@G\ 0llreportG@G8G8GpGpG`:8G8GPGPG`G`GpGpGGGLVM-/sys//dev/mapper H H@@*DLOROehlAh |@@h `  X jA   P #)-6:DwHRV`dnrNa|Y?KJ.|YK-6:DwHRV`dnra|MHHGA$3a1 GA$3p10670$GA*GA$annobin gcc 8.5.0 20210514GA$plugin name: gcc-annobinGA$running gcc 8.5.0 20210514GA*GA*GA! GA*FORTIFYGA+GLIBCXX_ASSERTIONS GA*GOW*GA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realign GA$3p1067@GA*GA$annobin gcc 8.5.0 20210514GA$plugin name: gcc-annobinGA$running gcc 8.5.0 20210514GA*GA*GA! GA*FORTIFYGA+GLIBCXX_ASSERTIONS GA*GOW*GA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realign GA*FORTIFY &GA+GLIBCXX_ASSERTIONS GA*FORTIFY@GA+GLIBCXX_ASSERTIONSliblvm2cmd.so.2.03-2.03.14-9.el8.x86_64.debugh7zXZִF!t/[g(]?Eh=ڊ2Nnۨ—~K0u/n⩆p^ }cyj *kՇu.n?.8W~0/cK8C?iXRjȦp`eKД prG-%IiK*J6n2 3AГ8ŹG8E !ElZ"}irY\3d4>uӻ/ ˚cTP>'5VH\q,TA*iVu>QD ;Ou8D6[AF٨dY%_fJjQGB(h'Z<4 <7!q0h짷³CC+iC r[N,8V2\*|ň0VğwH$on %9bUإ?sgq+;ݤ)3K@ #8*O{6ĖmwQ59t>a3׵Hx'Gu lY]4e`ߊZ]XO?Z :=dhqOU b!c}1FAjy; ,X~`WaO2 w 1C^Ht܏^p(!e8935lb1X)Ur;d~e]_$̲73 ~ɞ .ᰰxڧe_-B/PR Ss~Et='QȾq(ԉt1T*IMkQB藸Fx T9"0hdph]2_5xt0H9 ?n;&˓hY5p,R Higm/D !$#lWSS[0W甧ʶvSAd@ hxq'f)/o2&H;98[J{ՖMXQF*)À_5Pc>IB HKqЗL?.͠ :㭌Ru\`=v(sU`"j TEb B_}SV ]=B+] HEK}^ }v'ME*ƻBaac `֋DލRDCD^)JvJuE 2z|1ђ r +A}KO` !PA(<{ZL6WW(_z װoѳmMi3?6`W%nzlİXR E5Q2694+{rIhFgsbz/ˠI(xBtҾwȫ`%qw|=)!+@?)f⃟QIǃ.(w-9nc*_sm#&}8) B/PGW2f?!e@aDWȔႶ`}v} `$ҽ!V{ЂnGd80ék KYA>NSRPyWiܻ'0D("H݆ >ѹ˯˱篑/Lm,֧>p*ڹFchP^ p)a^-HZS0;5*0gR+&kMenΒu4wYY5Ɉv> -5?S hc;,1$2'^C̬M^ iBl,5+e.M N<0g#^=w! ZD4-+MZ?|C3ez@$US "gri>ʺ9Ofx4I9LwJFANGكuĽpE'/Y7I ʨ- [~Y ǢnNVh L|k8&JjϒΗLlX:CCp3m!cewئ27•y4܁?`>uC)~V`$3M IDL eoRMz̃OG[?:yM@5\a!ox.jeS7i1v|c3Venx/B¨I(bI=}\?́|#1j1MZ۾'y\OLH'*Q;Cx]w:v+$L`i/iξxL\; ž+sųpĶGw m돹T=po9JM$j u`Zt7K_RKlpwbs?V,{'4θVd!=ʵ/ xDAsضf"[]8|!_0 r;qe5BS%h:N4:פ>RT#XjBkddۤGjS+|n LŃ]M:oPsߊFuIi~x^xC IӦw4:hvj:|$ .%W,K 107z?;beF$-VJB,ݗ$X'I'r$yc`*/%*߰8g0L޺ިޏ= 5{-pE\?_@_3>!,N{uCeW-Cf'IwL=ߣTeX)) 607f pKT:Jc6fH$)Gh,!6YrͰJ2UȤ0n+]J ծķCaO^ܿo^pci凫=ABa[l9aUe1ͱ{ ;.Q(bۋ9=9FdPrjgIh%ëO}Ҥ ,QUwtR g7pJs{e>M`Esˆ H~גG Ixq-cyIߊƇ&.W >  \Sp).mHҎsræ!gpg~ 7Zw1 .Nd<+,/(~Ӎ˙9agNUͰ,E,_.Bi4;:J'ևKƚBebe ';q&Qdᥕ}.@]umŢ,.P9? +- 6F N>Jqqv'S7z (_`;/ I*(s*$!l2;{"H6'>MIuQ}*qh\~wΠ!(TZ:৶>;[ВKz.I7i3‡B`*V}!y9{SѡSHxV]OP1^m?XՕawX.2:Õ?ҩ{zpQBo80+@z}A]t0#aϕ-N%Y3ІN~=\uEo/' HndGETzPb{4Zj8di<&Vr7y^SRxj&;ufɮh4½vH]36Ֆ&a-&gJ85q#;28 ̢oߚE=ޯ^ٟk79jiOܙZm6p9*`ťoH)1B?}#5^^jH-Uf)VΞKW.]CILc)x d`Sf(3 WZ P2S]2eB̒Ts>284O\et챫sT:I{ 5)jwLsΆQvz5yέ͗Y|"شksś0jBaThAʨbNO&iR [U??DL.  @JVұtpyq3o`Kg4 NIE=X.GAGb`ɁŬkʖY!-mQ7to=|Ը!G4P}S#[Y}8)6zZ&V4+7F@o2W+ʘv&S\n-90糍NAmLJ|=Ը?, aAA63(Yqc8'c? z+dHUXY Gn:cWt~Ud@ 5+&w!D+6]Jl9GdH 0VV]za/]g<5F|ly0=~UJz<9&,נC/ը›Јs T“TAZB K7WTN$_a-`m:]t$!jUC~1k#72\v<fsEEWSD3;_ t[UJ@]֩7ؗ1j4þ>;_m _4Cw7zWuWJA+bJ#죶 e\U{JmP ø2m_$PdsP2٠)x'2}*j /$1ʖٴgkD8UR{yu p|RԫV2Ncfw৘jyyQT7գ_ &`ߨwI^7[&_ch,&tD/gMޣnӡeO~V<9/Qk"Qv粞^/'XT'w7\+U[2j?é$۬ru^AJcR)ez$Ӹ J0XbaQs_#/ۿk]Q4 w'")^phO Pa&)FD <ަ,n䨳Od`tf^ (pugG w˚rErE\ o{A?vuz8P=2IZd$a?dwH{IQ?_dx`B hД\NUnc2/P'Ԇ炮i܄숲?<0xaj4Q]D'9`ο)hHC,8K^O=E6`VeB䕘l[wG Bu hmĆjf.7yzX4c֭~"H+[x3DJm}>_ cm&X0Q_ocҷd6UzRRr^ا7 U`b(U丣@ᐵGsiA{ʞ-9%9!jFr]IYor9x1VeT_"|^Z&ıj@l% _ʤhqڂZ}_F5[M9+,\1˜MdYPw\ꐪ.8PfE,&Nxj!ɦ6J _E2W$,^}EWd\t16lI2<(r|E"mFnf0GqNY,E% ;j4Ǵ?.ˌb5*GJYƙ|; cpV ,L|/_C;#]12x&}iPYJ䁞A+,]p=P(W`}@$%Rx@Ȕj5Etw"ݞ=  iS%.iz$q[=u3u?.K_;D T=9Ǥj;X~Ʈ0fFSTBڼuls.i]E60 ;ǽh6aPK^%`<S䞇Zw~I&6yrSHZ@ArͣdZڐx+ xv9%"츌h3(.܆A`__p0 4{Jc{ǫRОҥfv'e_.1/^GlR)Q7,fG&`8˄ѳ Qc*,WnkhB*@nx PM1{gV8fAeО$u |q//+U#EaL{>*QLI?F+HMrj$}OrFZ!/+\/k]:3XɽֆV9p$ K݇><%K=;<*ZBqzN9Ő:k ٔq|r@!'+UvMUB3 ž0_S TwzljY^|Ϸ{m9 v3fvKYyYڙ0V S%vaDo78}EZyL &hcXV2+  O?)?0P2˃1`>vTÎfvqVӭQ(y&/뉮06~ }_A7kˎ:!66c̕eX>ArVq_*{r8nH^-zOpMS6H7*f\K> x'^^ev)GkyXW[IHYzwՆ Ea!1٨& d _^BVCŊ v[4Fk>V7y&%r/ $B:긴]MfEc' LA/]Hձ#UEqQ bc[&|r&lmYy/$d]I%씢*6a$kx U @Ƹbθntrν?EÐc ?o2>'T*u6l ˽^ELg9t'Ik}E!ri+_F@AP'T{5QmiWUx%ך݊J?>3cv&.j}|=2a^we.D?~KJnGw} #XL$V^L;bDROvnPDQ8"CA0}@wZ[Zѱ߃A\F 2J-6K6ZE3 8fla~XZnnRAμk9RS7 ČJ"^qzŗJ{6re]mYwS{v48S s1W'xg-Y U?Kirk]#ƈ#5{i? Ʈ = KDaS( \IX_2b|T87ɪ JX9?ED1ӏ88!ֹڻJ]JNnKtsVks.(\n^y`?ط#vr NzkE#]2dm~7ÅP!9C̄%G'`o>"Tpx"k,ΛLlVp@J2_[_5'@.޵tzf^7?._PQ25H]8}3A`N~✪.Ruvngq$C L mVF ,h<AS0l)\ A]VKFh)or*u Mx $ک;֖+OqlҖBԅҥ~uW7oVSݜ|i M& f"C_©,ar0/i>NeqG5$!1FQS7U?&8:рRfun4")Gjj0A "|@l Tބl" uZo@t e=h/H}WRi* g@rݗx1so]V,´!)Z57TR wiS k`]n`Т.`׭#ą[mr Y[dvk)ꭌsa>K_c #)P [dKx?ǑZ l,h٬/I7NhO+i2~%{#EU_ jPZkP` jvG'AHKIrȚn4X~DhwL}x+q>#ysc)@ϗYgz;FG)UIdina/2g 4N.;Dqn2ضIu07ŻS!\74Y ¸%C):Ê .ؓET"ܢlS˛ג [e bKi3Nz `l2_M[hIX+D96&)9Ȑ,S*H&R]Ղ/UG ╚ʲ|B~gRUb1{k4q_Z*bTo= j yƭ?b\LW'嶇brVs ,Yy^OBg>=OFs@ke1 ">Wt UNs튽dcry0 #qVQ]2֓["N9׻a[Cl1a(A3gZE,kv3Zy;QB+&8Eb0+`'Ct }2|f@W+2{_W]^Q`}҂\=^c\@A&CtnRvUEC*:!&{3O<O;Vc}.4ipv'hcWMA=8Bس(N p3"%!z%-gO^y}\'օ +&~d(˔wxN\x,f0wxaDl.R_Ƨ߫,;PDfw{ULDw 0 A$SnxL5wjg ? `YJ|U؟b0 ~{TqX&bd*i"~nL|Ӳ2]ЅGӄxc .j 3geaZA@,u,kԔӮLK(#+> v@]=!ʭS&AX+ǒSc4i©Ug&wJRDk>!Y^PgQ_NӖN@C Oc8'F҇tVG:j`>mYޫI{oӆ=vی-Ruw qHe=dY~wT{sXcʴO5:̻)*2UYϵSi5HGw7j,MZU_y4Z,QBdŠaI } :0I v$϶Zȴ& ;iWCpo:[,7N0?@+ sw nFya&$KJyq1$yHĠGB  nnRM؛gV 8ྥT>xϘ9WJ]r d  7`KX{^Bڶ 9N i4Q7xvTJ tPs}Yj99d ( FNP-` xSrMU%DeosTN3l,w uAbwp붷DRN`U%g7< .0 P(L>aK"\ /t0c)CZR1gGٳ#5 qh'"܁:}[O]l Mg$̟Olb\qE㫛>+ C4nl Bw=#,oE)rVQ $ !;Qrʔ=gULˌFY@.,-7Mɂ]QJ%XDfbfI-nrd A>sCVFn[lUTRzFgφgbm<`GqvKH[gMgjY"nL8HGźvOh zzQc.251R`'Z$ 2p=& У1V!__~=^''{6)4> \'b_T‚M2 5jJz2]bI#"?j<>Ł [?׏Fu-Bl nʕVÈ0s3NJImT_"ZΉRXåEr(im ͡t'ܨZ'# j9M쌽M6r@rlT}㖃Ֆ^{xcrt5,)m$e|Op YΏ>yF kM D9 TM׹j5gi":覕X\SG@e`YB>aOu8i]yÄ< pɄLE9jT.ۿ JuEt*Ad Z>bmQ@M8O?1ȂW,B"XPCË򲁘xQP\U>~@Z *K[qҐЉs‘SOIŸU E xP֑k({,l܄޷dW_~l&W0jdZdZ)ޕj`a !RQ&XQ GȤuɵ׭,~f$|e(ZDr?q{2uˊy;}{! ++dVx=7"blyK`PF}xљxˋ1>RM HCi@$y8q&08w9\kADBӯz ) v79 &o6gmEz70^͑hVM&fwI!yr;g(YxO/^,Cgмbk9jT7VT~Qw|`Hbdh,!b^T^+B1ww3n`46Cj袋uFo1D H"/kiۈ7=uE/psէ@[ 4ZT !NmH{N:V;9˳yփ5߻r_(lUYf;Fz3@G 7H;{Vä S#Tm M}U5x+b&Y) ɼrߊR&NDcG_]dU5 G2ؘQ=ɂ3]:\U^,0͈2z],wh34gx"+SR"jC1?O/qU6,%Rλx$+[ԥ \֔(n?l>A^Eۮ?tʢs:=[+=YذIilVEj[l sH[[-NE5z,Wu .x]fgD(NI /&u-@_:6%d0]n!U*ϊR蚾0 2XedEw< tn֥ -.s<|³Kn+THWՀt)aѷgl vd{N'0fVVg+v+`Bf27*Zu[~?|B/1qf>~cޟ&)XqFq rb/nmZ"B>2$.U^% mkGl# {4^O=i"HP.W >8fV FLyE*;\W8%|w}[5*i-paJo?+4_|vZqag@E XE C0,`u&p?)ُ~Y[lC/-dа> K>PXb_ZBԦc 8،P4ԼZI&df~zq"SULßP,iP "0+A\F>]J@K{ 0?w0]r/.HyPRLM*l|PDF>|XwK+`h?9ғ|YM<ܤވU蜚i;Ҳ9R>H;wc{RŁQ.c`]][:\X,I~9TK+yJG8zPśkQ2EO!2;0㨐5$z CsTxޖ\V#qzpp;gq\g Z"3}vH ‡lYvl Ke8/CCXmZ,Wܙّ\ 9Eqex@͵~:)!J|䎹KZ;0eUI2TFf  g+)ƷꬿJF4jOuiX9<,q )U1Y4@nS YT'{m{'iۥVȊo>{M'ܘ _ {QI'6)]7:IEPtYF{X]Mx&{՞Q T50$qmNhIJ17BϮ.fx_ւU6&u%s< 1+FpF( y4*?{K5X~ӜSBBe þnb`J؁˓^DM@mISA4£cB'Wzusi 2v<[z -:Yo2Ȼs-luC"Ɖg`@eo=jf:Q^nQ@CZZ81 Ή`N;n2D-z?(_^PA6?õ%Xt&T\k+J&FAFۄԵ 53z&Ԕ]Of'ξ핝xZZ^ao:]Rso%;FD@X2Mks"*DmSF;d9xs5e\B+!$(<@Q{22-W?O_EF8Bͤ#D(Gc=g BHX^OC-r[sߕ1%N'YO'iHaI0/):R~rKq5'P)YGDyd__^&HnMa+%z* ??4 =LTZqg>׌OG5eBز@3D*HKa`3F?!r k6=vZIM;w;>l^ƕlDo mDKf bŕL\wизTit JTN‚ "VA }' ukS5&q"5 KNYzHHou}/\iVOM] le fDz\-,i7/u͊pyL8]s'3La)}=SL "6q#?ж~(=.@aQ8Fj`HY#$+6"~Nj,,)fY,ܐGΠ*c!怄i+ B.Wo05< s2ܤϠ!aEKןk19 )o/FOEi#w}ɲڻ1>v/@U,Bf7Kx*v1 - ɤkjY 4K8ReݣGT-^tz1Jh&[4yX_?[lNw iz,D]G -ӯc*GZ'O"gK?G19PUZkL{1#z<:GKߧ>' andRYA 2՞Rώ~۷tT+]w7Z5Pmteۤl%T?saDMdෛ(HƕZ#%FOUh4Qv/,*,1Iۆ rr$lE, ݣL/EN:z xp1Zf~ͪw|b˴|]55k UQ$6 f az!tW_D tcI9  0tR݇WbJ72u\Ҟ fτuK]}!'~1Ϋ>N$rQ4Z8&%dpmm/`g 1OsmmgdgB rohyx;bD}6?ȞtkuXNj!4h(mkG{TN]304+]0Iv dm$~ܑ::r:)ſ;q BT=PaSLcip>HVh$GO/쥋0%O÷48[OɌN']sP\GF;PlKbkaV#B p 6Vmnj,w۵ vei4*4:&珒BߧneE?Qj/kມ%\w 8߰ȯyW]׬XIfA?o2AbJxD$m }ty/}Uk' .-ck%3~p "fBfs"w8[nrtlEozӬ O_N?8[z$JlZWb2:*S #!\g/SP o^cOS X_͹ϏF}\9I>$Nf|vlcGE21XY],5J-Uڞdɸtb $ɇIp#9of |x, YoĔ {jn[ Žپ0opFB箩e/2oyWN4,5~wEx@rLV D|' ZBT;d X+?-|JV'VS 1|1PN,"Q*WS iB%!Q<0N-TO&liJQ 1uQ*Xv9$F7Ι^~b(s.W?K2+ ~kG[gGQzʌCffU UBF\-YK-v]ƒq|/u_:TKE~n(PyA% %{^8|*% _%7 2]f舯:"%T甓4Œ$:&QD2S]\ ]5O L:= K,Ȇbn=**>N˂\!P:nMMi;S@R@4>pCnaڑ%oz=NM!b-)@74:)'TSܚnً;6Q;@> U\gdW^$S\:\4wo0$]W>صV!*fam< R Ѧ2ͯwҢ(Q ã3M9*nHˢ὾0W-@NW3t{7gPoot4>9(TŸːluKO61a6;l2!bHWOh{͉'﹯/uW)d]7fyd 19SZoa~FJY[ rIԘHoǚ=n\C`g (;r:Aͫz"s>-s]e?|~ߐUGdoK]mD]8Y9H+ҁ1*-c@șL8#sOFes.q1%(TuSZ(2[>+)vIƢ.y8_]yU1*ũ7|Le,IIhbꕏbHO h&MNo -T+Wqy9Hj-k p҈ 6wcdm" ktq= 8=էV=dQB]IW؍xrT<恣u_Rr1 zvA<_F IWo,JBt@iD \C>R3ɼKG~:52t7' (4< ꑨX:u༟SRY# u>oFRa8~?Lýi\&-9_BkER`|$v]}Wv^3簋ν"׭kQQp1c9[\+LYkշI%y]Ru 鼺DŽ}blTϵ ܑB3T{*Qr-lEeWa8LQhU[=J‰GYQIDẅ1J @<*sHAfy|I!J=&ëLLS+Ƭezzex;uљ7u;dQV9_*|sl̅LRj鳙E(0OX}lc@ x> 4~@W;L [X_VZv(eZK7FHrZq&Ź`/yV"]{aDA? Ovd:mw`}^` r~q6<,E L4@nIziTFXs^P=N$3 c9zZ&}˅4`M-l~[kL '8@CJyL^/?pj@ Bު;ٱRn񬙦343fФӖԋV~`x2Z|,WIojuòt/^v?7}bL{3$XYy>Ua$`_]hqI;Zxֲ wsy=JH4>*)|Pz:!qs lTPc.݀IS YoYoS/a i,m x<ߜ Nwz9Zd04_YxaLtb~IZU~L\hQ̜guF2||c.{3&ߡ×17FW51O mI{l>A+RY'ͳ~gĜTR5Lu 㜬{#T\O{? ٹu]Seф-ϴ Cwo>=kbjK铎#rRu(hM0s,wW}Q *OAZUĝ}V,{h^1p;zx,OKGS Ɵ\e0b@N](;/W}Cx$wղ;t /R_I/w߲(R!_7Jy=#|W{ԙ vƷNLD~\Z`OW%/z_dүP1dyv5iܜ}nqd/ų*o4Y7`sK O]ӄA'ށ/`E3Vǟ2-vQr72zFi 0ngT" }Kq~k@|7,{ŕKyNcuK1ٝY"Zj;+o]Y+eN/E6q hNCSZm}nM{);F>scKTys1uQ k(]gtM2pZLOo*M=V0-6͉"r-V 3%oFxaͭM#SƫEz,,t҅jQtт?hVy+(e?60 3@a91]2;|:4̐!V0  p~A#SKE8>(::{IJCx0wZ3u#]Lyͬf@~DyU?^1e%G6@hu n_,nԑD` h-=X5KNC#KXtCsgqelԿKbpъQ^)*%Tkݤ'!nKHw<C\Y3Q(+Q2OOdrݾ'SLCj)hf6lWqMi_0߾Q!BC&,":i8#I:ļ\)`R՝vJ/^'}̴xs?Y"P4f:`rf)d`f,x0 sl6^W!"xt}PnfO`@+Evj?. 8 <ĆSjgaJo.КC:?O2?pA@O0mx yŷ6#LA-PV¡ɤM@jRXԯhKTxD^x=?h&̘T s(g/wT8u Sl|dRB[,VFv1H4vI­8a˰~J/ f2'#ImK#/5`,sPhO/xr -]ĈK/̲Zx.T.7ٙBy& +đgpM(Z^1a9ʧhPQ ("jI[D| vfE>38]Wj^枩VNQaJkFt?a ݜDZqm E5]|:Oz-U4p)K jLʞc,D[>cre h\cD)#LkoyK 7]yӬ>'Xh+AmId׳7SoX"m(=W>,CS1(T<Sjw.= gԪ^GaWuǂYk^ p:hl+IOQmn+dEe;چǴ:<@ 5J-x,`j \Vvm?pz/߅b^ .hh4 ;9H~"`6\9q K^ܽdM;v)qխʹ$%NvVA~w+{(DG)S3C 5T/xtݽS̍7;F1ZS'mk>0~"t~$B`8ʲL6Z$ELA4ͦjh6qSE錳IHH.r\kㅐⷶU3ߺ<{SyoZ-ı\$,x(rNbtQ*l(-1Be? sv1i3;h:p!WجVlh`>yҺ9Eý_epD9Bzvx TtՒ,vC !߈XP3?nHzA/hG1b! 4V{mwx)gPOG0-;` *28u@dVvOkP)u/ںoQSGig`2TUi6PTAGzUl\JXFS {$@a&= Wӵu/k߮gdF=Z&ݡki(UrVQ!w%c%t/P'N8MT$jHc7\ FfRgޓ{OsyBs]'H`Qҏd Bh gZ3h.lz@,IS0gVGbfigT 2sʜnG4gT8,R:;'ُq9nj>GZG͢eڽV\VܴjRX^9Un{7Ie:$O][By]{ZؐKQAZ;7H`1kxiUՀ O4O}f,p%@n ȟ ~hhn&xyhOW  -uQn5yhy,C]GBuo!?7u)zX2XS@]OfoM V} Rw8ec㹚>C734UP0EZ̐2LHloy}fXªחhdÖ5XڡgA0nr #'#!LW#n>>ZbMuҸ9w@D-ؾl?_H5b0- *&Y *~/} }x{udZʣSJl1"0F9}}?`6Urc4:ʄ/bVΝVM>F@)`DӞ6 f:n~w!)iPE]so{#[ -c0ۃ]>3)Ǒ`6#ΒؒKΎmSk ,ʒ{Ad}:Fy6&a%s'+l8gt1,җ1~>0fL& ʗD[33~39!-R"[n!>J A76^yfLp<܂7Xx #bmGt ؐPc.~>NE?wyD4 ["7 *UD>,Q'2T!mVw7_i  N,0z/W '[12τsvN o H1!)߹z`# TypK:.1Nz l>geSFvn H.#%Fጇ9'**Zzkt{C"h_IueA–0^? pp6UJ'3{]wX\ղ6ztdVӸqNӤ7MԚ u \h.UΐpcKb![|l/a* y\2\Ř# A.,f\LX4擈W6+TR(mhWYd,\nH4/MTmX08oEnZ83tųu>C]"kCGzM2["Ĺn;]d9!0WV~BM\qd)UgI "XSL4(@:`\;xn3ɺ. ؙn2AVb@+! 0 !8]$'hh/ml`r#.mk >^&dS+9Уc/sB~]'JdRo1pQm>C^ʯ! yQX#4e1+Vq2()$^\vn 4Z~Ta#:l|J,?sn&O, ;bdo\jai/\QZs)J?ѢghZq*WvR I-I?5ˠ6krE>{5q[;].=ѫ(\g4#]wAb u'/6J3d#7vB,x:'y&wՁ Ǭ(`Ylʇ% 6c)8tJU6Tw1P0{Bfl|"B/J02%*Õ9+ǘ=+T`7R1ZAÊ% ^8E222bLYvk>'e~ݒY%Sy7|Q<^7hRld.P݌H_@D]Q #ɉЯzGԝ;8NmFPnP@߲).lw*9Ͽ.*ۋsuk[0Bp _5(eZ6X" <6B @:ApkG͓loݯ_5B/:Wxj/_̲XqŴC6CL1^} ǁ rr =:T8O a1!A-[.lX~l nb&b:{7#.>ΜdjӴ&Mm寃~h _ŞdHhJWiŤ]B,ZުQçϠ07p>-񂥦߼}]#BjG,M˯44e?؁7fPy.}m;4e<^uei߿H?M*GfOo"cpI:ڝbkGLA QNeْ&֘)Y BsB.e`XNݨ&/nP魌cBHI-}ԛ՞SCpPO D[ӖѠΙeÚׂ]5ɻѽmg߹Ø#Aj'y 6,S*Ow \o^/jj0}u2ȟj;:D%7{:{xmI3~hJܕ't68*`&lA} .[ɷ{usmC"Ɋ@pYZL* h=EK`֒2s&hK&kreT*U[5ڲ?.Kq>b0wPZ҃]&bU8q⌲vJ(&O+"$9P;iéHl~][/t.?5UrH}Skp#y:?dIn(*G.'=vv,13wl<Ԃ,H)Đ;N fMJc/KUξ22_nR3_@6 !y"Ãᷠ=eM p]r#!/oqͿ:@5{=ަ9a!8t~4dL'3>vH&"b֨8;1U&$ װ1>澎LPʨⰾFe@!lOn'CDcijWi9D8FV?҇T_^}<[1)O6-#Eő^ʅ,|jۘ~mXe" ~AbSe )w Ҍd15ބFa4Unoe4H6fz쩽F5b fE4GOD/6a7^KD}xLyƂf o C؃F7l>~hZG&3VsrWang8 1u68V_ˋPtPH~0hB4t" Z2#{.uIݡR*c:%9q~4&݇/_b2ʔJ61jBtyG!>Ϗ#C6>=sT~"=ͥs])@6f2h#)4נ csʻ5 ikLpD_%@qX宪η)/SٻFE5Ź+]͐2? q==*>?pCR2`| Le{t\15:$rtչlNTCL"^JtCLs">`#чB3Nߏ#ꗎk(GJޚ5'9/Ep.=v{a~2#[| L6K_{:=Af_4ӵPLπxYqSΙ(x4D(0_ÌO(bπY`j粡4opϊ`% wF/#u;>bB,4ۛWr)jXpI-BD'TT̘^1M9ԛв>·K>hq6B5JUpM| »Z(Nx/i{j$2ha,ʉgަ{R3ÿdmA],|?-o)*-`Q 9j6%swtR:{i"Xr=cQ>uA7 u#ԍ 9ภ' `#_!^ ,_r&* BrC +2o)C̕Jߺx?˛Y[&S^Ϛ wq)Ja#It>EKCU[`Em4! 'L_!I0rh,L/`1Z#HWriҞnF] \"u ( fJe5](/`h-{@8 s`SqJ RQDN\5"GHj<+NՖ(EpŷnD5K뭁9Z;A C<5G1@:kႉ {Mh~ἱhdq֨,/C\}q<έw2(?#.E4JlIM{ppZoI~3p 9QΚ=tkE(E}4y֚5 iy˧Q/T}яu<:w\k;AgV#X 9yJC|e1#~#rO(AAJti3[RgZTu&G9lfr=pwG# 0B d}rJ>!q:ǭ26Uu˴ጻa{l@k-D~zQ3J'D>NA&6:AK2hk2N:$TasaDdaa=lc*`Θ 1*f'i[ U!p'9% 35;KmO4Dq4gew_:$L 'MF5A#5.3f׸pOWA0;T:'…3h֚-~jRx(IW0tNha~#K`|h=qЗ \Kk<{fԽ9W96 IjucQXyNɽ)xiW' \[>k _":復81`(\O>,[ Mލ*l}7\ UdrחtW|Ot Z)#aW*3I㦥 al ofㅧ+po_c\-fFXD'}QE/1`niaC~ ݯ [:vdNJf QSœyn50@`vu[>68 rb-3{SA愢. HiǎOOkg]#7Λ6*wãn2*ve2yGsֽKsh:NJg?J*~̵5Y 9#}:09ړ-C'TLk[?ezr!!󚃽B(7)a$ǗX뵙EB ĥŪ$%…ΟaOTa&}CօS:3bCBG.xBgg' ?LW^|$)ͷ}5I$C0@Z@_~p0@UZ0S?\C[j]a *bO⹤I抈 3խٵ2j-rЊZWWQ,75Ok\V.r/xMe,`\g1@e_jwI4~f@WIu28AJ%ê@Q!hLqQKg\}z>foJN|]Ġ gYZ.shstrtab.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_d.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.note.gnu.property.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu.build.attributes.gnu_debuglink.gnu_debugdata 88$o``D( 0HH 8o((((Eo * *8ToX*X*c(,(,pmBwr}0$0$X 7 PPkPM PM 0N## C#C#C#p 05D05$7D7$ @D@$  H( ) @(l|#(4(#(h(7